KEGG   Aspergillus oryzae: AOR_1_362184Help
Entry
AOR_1_362184      CDS       T01018                                 

Gene name
AO090009000219
Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
aor  Aspergillus oryzae
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AOR_1_362184 (AO090009000219)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AOR_1_362184 (AO090009000219)
Enzymes [BR:aor01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     AOR_1_362184 (AO090009000219)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 538 aa AA seqDB search
MGFLEDEDKKYLDDVQAVKAWWTDSRWRHTKRPFSAEQIVAKRGNLKIEYPSNVQSKKLW
KILESNFENKVASFTYGCLEPTMVTQMAKYLDTVYVSGWQSSSTASSTDEPSPDLADYPM
NTVPNKVNQLWMAQLFHDRKQREERITTPKEKRGNVANIDYLRPIIADADTGHGGLTAVM
KLTKLFVERGAAGIHIEDQAPGTKKCGHMAGKVLVPISEHINRLVAIRAQADIMGTDLLA
IARTDAEAATLITSTIDHRDHAFIVGSTNPNIQPLVDLMVAAEQAGKQGDELQAIEDQWV
AQAGLKLFNDAVIEAINKGAHSNKQSLIDQYLKAAKGKSNLEARAIAKNITGQDIYFNWD
APRTREGYYRLQGGTQCAINRGLAYAPFADLIWMESKLPDYAQAKEFAEGIHAVWPEQKL
AYNLSPSFNWKKAMPRDEQETYIKRLGALGYCWQFITLAGLHTTALISDQFAKAYSKQGM
RAYGELVQEPEMEQGVDVVTHQKWSGANYVDNLLKMVTGGVSSTAAMGKGVTEDQFKH
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgggttttctcgaggacgaggacaagaagtacttggacgacgtccaggccgtcaaggcc
tggtggaccgattccagatggcgacacaccaagcgccctttctctgcagagcagattgtg
gccaagcgtggaaacctgaagattgagtacccctcgaatgtccagagcaagaagctctgg
aaaattctggagagcaacttcgagaacaaagttgctagcttcacctacggctgtctcgaa
cccacaatggtcacccaaatggcaaagtaccttgacaccgtctatgtctctggctggcag
agctcttccactgcttcctctaccgatgagccgtctccggatcttgctgactaccccatg
aacactgtgccaaacaaggtaaaccagctatggatggcccagctgttccatgaccggaaa
cagcgtgaggaacggattacgacacccaaggagaagcgcggaaatgtggcaaacattgac
tacctgcgtcccatcatcgctgacgctgacactggacatggtggtttgactgcggttatg
aagttgaccaagctgtttgttgagcgcggtgctgctggtattcacattgaggaccaagct
cctggtaccaagaagtgtggccacatggctggaaaggttcttgtgcccattagcgagcac
atcaaccgtttggtcgccatccgtgcgcaggcagatatcatgggcaccgatcttcttgcc
attgccagaaccgacgccgaagctgctactctcatcacctctaccatcgatcaccgtgac
catgccttcatcgtcggctcgaccaaccccaacatccagcctctcgtggatctcatggtg
gcggccgaacaagctggaaagcagggagacgagcttcaggctatcgaagaccagtgggtt
gctcaggctggcctgaagcttttcaacgatgccgtcattgaggccatcaacaagggtgcc
cactctaacaagcaatccctcattgatcaatacctgaaggctgctaagggcaagagcaac
cttgaagctcgcgcgatcgccaagaacatcactggacaggacatctacttcaactgggat
gcgcctcgcacccgtgagggttactaccggctccagggtggcacccagtgtgccattaac
cgtggtcttgcttatgctccattcgccgaccttatctggatggagagcaagctccccgac
tacgcccaggctaaggagtttgctgaaggcattcacgccgtgtggcccgagcaaaaactt
gcctacaacttgtcgccctcgttcaactggaagaaagccatgccccgcgatgagcaggag
acgtacatcaagcgcttgggtgctctgggttactgctggcagttcatcaccctggctggt
ctgcacaccacagccctcatttccgaccagttcgccaaggcctactccaagcagggcatg
cgtgcctatggtgaattggtccaagagccggagatggagcagggagtcgatgtggttacc
caccagaaatggagcggtgccaattatgtggataacctcctgaagatggtcactggcggt
gtgagcagcactgcggccatgggcaagggtgtgacggaagatcagttcaagcactga

DBGET integrated database retrieval system