KEGG   Aspergillus oryzae: AOR_1_364024Help
Entry
AOR_1_364024      CDS       T01018                                 

Gene name
AO090010000205
Definition
ubiquitin carboxyl-terminal hydrolase isozyme L3
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
aor  Aspergillus oryzae
Brite
Enzymes [BR:aor01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     AOR_1_364024 (AO090010000205)
Peptidases [BR:aor01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   AOR_1_364024 (AO090010000205)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 250 aa AA seqDB search
MSTTLPTGAKIINGVKTFIPLENNPEVHTHLATTLSVQSLTFHDIFTLSPPPRDLPHPIN
ALIFLAAAPIYTRARSTLQSTLPKYTTTNETDPIWIPQTIGHACGLMAFLHCVLNLDDGR
HLARGSELAKLREELVSLAPGDRARVVYEALFLEEAHMDAARGGSSGVPGPEEDNGFHFV
GFVKGGDGRVWELNGGMPGPLERGVLEDGEDLVSEAGLRLTVGDFMEAAKEVEGGGYGGL
GISLVGLVGV
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccacacttcccaccggcgccaaaatcatcaacggggtcaagaccttcattccc
ctcgaaaacaaccccgaagtccacacccacctcgccaccaccctctctgtccaatccctc
accttccacgacatcttcaccctctccccgcctccccgagacctaccccatcccatcaac
gccctaatcttcctcgccgcagcacccatctacacccgcgcccgctcaaccctccaatcc
acactccccaaatacacaaccaccaatgaaacagacccaatctggatcccccagacaatc
ggccacgcttgcggccttatggcgtttctgcactgtgtgctgaatctcgatgatgggagg
catctagctcgtgggtctgagttggcgaagttacgggaggaactggtctcgttggcgccg
ggggatcgtgctagggtggtttatgaggcattgtttctggaggaggcgcatatggatgcg
gcgcggggaggtagttcgggggtgccggggccggaggaggataacgggtttcattttgtg
gggtttgtgaagggcggggacgggagggtttgggagttgaatgggggtatgccggggcct
ttggagaggggagttcttgaggatggtgaggatttggtttcggaggctgggttgaggttg
acggttggggattttatggaggctgcgaaggaggttgaggggggtgggtatgggggtttg
gggatttctttggttgggttggttggtgtgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system