KEGG   Aspergillus oryzae: AOR_1_364074Help
Entry
AOR_1_364074      CDS       T01018                                 

Gene name
AO090038000224
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
aor  Aspergillus oryzae
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AOR_1_364074 (AO090038000224)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AOR_1_364074 (AO090038000224)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    AOR_1_364074 (AO090038000224)
Enzymes [BR:aor01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     AOR_1_364074 (AO090038000224)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 534 aa AA seqDB search
MTSTAPTESQKFLSTRGGDYGLSFETVVLKGLAADGGLFLPHEIPTANDWQSWKDLSYAE
LAFKIVSLYISPSEIPPEDLKGIIERSYSTFRAEDVVPLTHLQDDNLYLLELFHGPSYSF
KDCALQFLGNLFEYLLVRKNQGKVGKDRHHLTVVGATSGDTGSAAIYGLRGKKDVSVVIL
HPKGRVSPIQEAQMTTCTDRNVHNLAVTGTFDDCQDIVKAMFNDPDSNQALKLGAVNSIN
FSRILAQIVFYFYAYFQLARKSPTFKVGDKVRFVTPTGNFGNILAGYFATKMGLPADKLV
VATNENDILHRFWTTGRYEKNPVQEQQADGTVKAEACKETPSPAMDILVSSNFERLMWFL
AKEQAAAAGLDDASSKKRAGEEVLAWYQSLKATGGFGPVDKDLLENGRSTFDSDRVSNSE
TVETIKSCYQETKYVLDPHSAVAVTVAKRSLAKNGSNVHHISLSTAHPAKFSEVVESALK
GEAGFNFDEQVLPDEFKAFAQKETRVTTVENSWEKVREIVKRQAEEDIKAESSA
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgacgagtacagctccgacggaatcccaaaaattcctctccaccagaggtggtgactat
ggcctctcgttcgagaccgttgtcttgaagggactcgctgcggatggcggtcttttcttg
cctcacgaaatcccgaccgcaaacgactggcaaagttggaaagatctctcgtacgccgaa
cttgccttcaagatcgtcagcctttatatctccccctccgagatccccccggaagacctg
aaaggcatcattgaacggagctactcgacattccgcgcagaagatgttgtccccttgacc
catctgcaggatgacaacctgtatcttctcgagctattccatggcccaagctactccttc
aaagactgtgccttgcaatttctgggaaatcttttcgaataccttctcgtgcggaaaaac
caaggaaaggttggaaaagatagacatcatttgacagtcgtcggtgcgacgagcggtgat
actggatccgccgcaatctacggtcttaggggcaagaaggacgtgtccgtggtcatcttg
catcccaagggccgcgtcagccctatccaagaggcgcagatgaccacctgcacagacagg
aatgtccacaatcttgccgtgacgggaacattcgacgattgccaggatattgtcaaggct
atgttcaacgatcctgatagcaaccaggctttgaagctcggtgccgttaactccatcaac
ttctcgagaatcctcgcccagatcgtgttctacttctacgcctacttccaacttgccaga
aagtcgccgacgttcaaagtgggcgacaaggtcagatttgtgactcccaccggaaacttc
ggcaatatcctcgccggttacttcgcaaccaagatgggtctccccgccgataagctggtc
gtggcaacaaatgagaacgatatcctgcaccgcttctggacgactggccgctacgagaag
aaccctgttcaggaacagcaggccgatggtaccgtgaaggccgaggcttgcaaggagaca
ccaagccctgcaatggatattttggtctccagcaacttcgagagactcatgtggttcctc
gcaaaagaacaagcagcggcagccggcttggacgacgcgtccagcaagaagagggccggt
gaagaggttttggcctggtaccaatcattgaaggcaactggcggcttcgggcctgtagat
aaggacctgttggaaaacggacggtcgactttcgacagcgaccgtgtgagcaactcagag
actgtcgagactatcaagtcttgctaccaggaaaccaaatacgttcttgatccccattcg
gctgttgcagttaccgtcgcgaagagatcgcttgctaagaatggctcgaacgtccaccac
atctcgctctccactgctcaccccgccaaattctctgaggtcgtcgaatcagctctcaag
ggcgaggccggcttcaacttcgatgagcaggtgcttcctgacgagttcaaggctttcgcg
caaaaggagaccagggtcaccacggttgagaattcgtgggagaaggtccgggagatcgtg
aaacgccaagctgaagaggacatcaaggctgaaagcagcgcttaa

DBGET integrated database retrieval system