KEGG   Aspergillus oryzae: AOR_1_390174Help
Entry
AOR_1_390174      CDS       T01018                                 

Gene name
AO090005000217
Definition
alpha-galactosidase A
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
aor  Aspergillus oryzae
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:aor00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:aor00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:aor00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:aor00603]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 534 aa AA seqDB search
MRLITRWIPLANALASTMPVQVVASIENPSLLPTPPMGFNNWARFMCDLNETLFVETTDA
MASNGLLEAGYNRINLDDCWMNYDRAENGSLEWNVTKFPRGLPWLGQYVKSKGFNFGIYE
DSGNLTCGGYPGSEGYEEIDAEIFAAWGIDYLKLDGCNVYPKEGRTLQEEYKYLYGNWHE
ILSKMQQPLIFSESAPAYFSMTDNLTDWHTVMDWVPEYGELARHSVDILVYSGEGSAWDS
IMTNYKFNTLVARYQRPGYYNDPDFLIADHPGLSLDEKRSQFALWASFSAPLIISAHIPD
LSSEDLEYLTNQALIAVDQDPLAQQATLASRDGSLDVLTRNLADGSRLVTILNHGSESIE
TDISLDILGLSTDCTYKAQDLWGGSTQTIKDAIRIKLNTHATAVYKIDTDEKCSQVIPTG
LIFNTASGKCLTGTSSSVGSESCNGSKSQIWQIDASGVIRTLSEQSKCLTADGKAISLQE
CSENNGQKWSYAITGNLKNADTGYCLTNGGGVSACGFETNSQVFGLPAGVHVAL
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgcgacttatcacaagatggataccgctagcgaacgcattggccagcacgatgccagtc
caagttgtcgcttccattgagaaccctagtctactgccgacgccgcccatgggattcaac
aattgggcccggttcatgtgcgacctgaacgagacactatttgtcgagactacggatgca
atggcctccaatggtttattggaagctggttacaatcgtatcaatcttgacgactgctgg
atgaactatgatcgcgcggaaaatggatcactcgaatggaatgtcaccaagttcccgcgc
ggccttccctggcttggtcaatatgttaaatctaaaggctttaacttcggcatctacgag
gactcagggaacctgacctgtggtggctatccggggtccgaaggttacgaggagatcgac
gcggagatatttgcggcatggggcatcgactatctgaaattggatgggtgtaacgtctat
cccaaagaaggtcgtactttgcaggaagagtacaaatacctctacggcaattggcatgag
atactcagcaaaatgcaacagccactgatattctccgaatcggcacctgcgtacttctcc
atgaccgacaatttgaccgattggcatacggtcatggactgggttcctgaatacggcgag
ctcgcccgacattcagttgacattctcgtctacagtggagaaggcagtgcctgggatagt
atcatgacaaactataagttcaacacgttagtcgctcggtatcaacgtcccggatattac
aacgatcctgacttcctaattgcggaccatccgggactgtcactggacgaaaagcgatcc
caattcgcgctttgggcttcgttttcggcacccttgattattagtgcacatattcccgac
ctatcatctgaggatctagagtacctaacaaatcaagccttgattgcggtcgatcaggat
cctctggcgcaacaagccacactggccagtcgcgatggctcccttgacgtgttgacgcgg
aatcttgccgacggttctaggttggtcaccattctgaaccatggtagcgagtccatcgaa
acagatatttccctggacatactcggcctctctaccgattgtacatacaaagcacaagac
ctctggggcggctctactcagaccatcaaggatgcgatacgtattaagttgaacacacat
gcgaccgccgtgtataaaatagacaccgatgagaagtgctctcaagtcatacccaccggc
cttatctttaacacggcctccggaaagtgtcttacaggaacctcatcctctgtgggatct
gaatcttgcaacgggagcaaatcccagatatggcagatcgacgcatcgggggtgattcgc
acgttgtctgaacagtcaaagtgtctaacagcagacgggaaagccatttcgctgcaggaa
tgtagcgagaataatggccagaaatggtcgtatgcaatcacgggcaatctaaagaatgct
gatactggctattgtctgacgaacggcggaggtgtttctgcttgcggctttgaaaccaat
agccaggtgtttgggttacccgctggtgtccatgtcgcattgtaa

DBGET integrated database retrieval system