KEGG   Aspergillus oryzae: AOR_1_390174Help
Entry
AOR_1_390174      CDS       T01018                                 

Gene name
AO090005000217
Definition
alpha-galactosidase A
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
aor  Aspergillus oryzae
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AOR_1_390174 (AO090005000217)
  Lipid metabolism
   00561 Glycerolipid metabolism
    AOR_1_390174 (AO090005000217)
   00600 Sphingolipid metabolism
    AOR_1_390174 (AO090005000217)
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    AOR_1_390174 (AO090005000217)
Enzymes [BR:aor01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     AOR_1_390174 (AO090005000217)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 534 aa AA seqDB search
MRLITRWIPLANALASTMPVQVVASIENPSLLPTPPMGFNNWARFMCDLNETLFVETTDA
MASNGLLEAGYNRINLDDCWMNYDRAENGSLEWNVTKFPRGLPWLGQYVKSKGFNFGIYE
DSGNLTCGGYPGSEGYEEIDAEIFAAWGIDYLKLDGCNVYPKEGRTLQEEYKYLYGNWHE
ILSKMQQPLIFSESAPAYFSMTDNLTDWHTVMDWVPEYGELARHSVDILVYSGEGSAWDS
IMTNYKFNTLVARYQRPGYYNDPDFLIADHPGLSLDEKRSQFALWASFSAPLIISAHIPD
LSSEDLEYLTNQALIAVDQDPLAQQATLASRDGSLDVLTRNLADGSRLVTILNHGSESIE
TDISLDILGLSTDCTYKAQDLWGGSTQTIKDAIRIKLNTHATAVYKIDTDEKCSQVIPTG
LIFNTASGKCLTGTSSSVGSESCNGSKSQIWQIDASGVIRTLSEQSKCLTADGKAISLQE
CSENNGQKWSYAITGNLKNADTGYCLTNGGGVSACGFETNSQVFGLPAGVHVAL
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgcgacttatcacaagatggataccgctagcgaacgcattggccagcacgatgccagtc
caagttgtcgcttccattgagaaccctagtctactgccgacgccgcccatgggattcaac
aattgggcccggttcatgtgcgacctgaacgagacactatttgtcgagactacggatgca
atggcctccaatggtttattggaagctggttacaatcgtatcaatcttgacgactgctgg
atgaactatgatcgcgcggaaaatggatcactcgaatggaatgtcaccaagttcccgcgc
ggccttccctggcttggtcaatatgttaaatctaaaggctttaacttcggcatctacgag
gactcagggaacctgacctgtggtggctatccggggtccgaaggttacgaggagatcgac
gcggagatatttgcggcatggggcatcgactatctgaaattggatgggtgtaacgtctat
cccaaagaaggtcgtactttgcaggaagagtacaaatacctctacggcaattggcatgag
atactcagcaaaatgcaacagccactgatattctccgaatcggcacctgcgtacttctcc
atgaccgacaatttgaccgattggcatacggtcatggactgggttcctgaatacggcgag
ctcgcccgacattcagttgacattctcgtctacagtggagaaggcagtgcctgggatagt
atcatgacaaactataagttcaacacgttagtcgctcggtatcaacgtcccggatattac
aacgatcctgacttcctaattgcggaccatccgggactgtcactggacgaaaagcgatcc
caattcgcgctttgggcttcgttttcggcacccttgattattagtgcacatattcccgac
ctatcatctgaggatctagagtacctaacaaatcaagccttgattgcggtcgatcaggat
cctctggcgcaacaagccacactggccagtcgcgatggctcccttgacgtgttgacgcgg
aatcttgccgacggttctaggttggtcaccattctgaaccatggtagcgagtccatcgaa
acagatatttccctggacatactcggcctctctaccgattgtacatacaaagcacaagac
ctctggggcggctctactcagaccatcaaggatgcgatacgtattaagttgaacacacat
gcgaccgccgtgtataaaatagacaccgatgagaagtgctctcaagtcatacccaccggc
cttatctttaacacggcctccggaaagtgtcttacaggaacctcatcctctgtgggatct
gaatcttgcaacgggagcaaatcccagatatggcagatcgacgcatcgggggtgattcgc
acgttgtctgaacagtcaaagtgtctaacagcagacgggaaagccatttcgctgcaggaa
tgtagcgagaataatggccagaaatggtcgtatgcaatcacgggcaatctaaagaatgct
gatactggctattgtctgacgaacggcggaggtgtttctgcttgcggctttgaaaccaat
agccaggtgtttgggttacccgctggtgtccatgtcgcattgtaa

DBGET integrated database retrieval system