KEGG   Aspergillus oryzae: AOR_1_406024Help
Entry
AOR_1_406024      CDS       T01018                                 

Gene name
AO090010000225
Definition
eukaryotic translation initiation factor 4E-1
Orthology
K03259  
translation initiation factor 4E
Organism
aor  Aspergillus oryzae
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:aor00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AOR_1_406024 (AO090010000225)
Translation factors [BR:aor03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    AOR_1_406024 (AO090010000225)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 247 aa AA seqDB search
MAAVAENGPVPVNDENTAPTVAAPEQKEETEKTNGDNITVFHDPENFNVKHPLMHEWTLW
FTKPPSGKGDNWNDLLKEVVTFNSVEEFWGIYNNITPTSELGLKADYHLFKKGIRPEWED
PQNKHGGKWSYSFKDKRSVPIDDLWLHAQLAAIGETLENDGDSEVMGVVVNVRKGFYRVG
LWTRTVGKSIPGDKSSRTPAQGKDVLESIGRRFKEVLRLNEADVVEFSGHTDSAHSGSTR
AKAKYTV
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggccgctgttgctgaaaacggtcccgtaccggtgaacgacgagaacaccgcgcccacc
gttgccgcccccgagcagaaggaggagaccgagaagacaaatggcgacaacatcacagtg
ttccacgaccctgagaacttcaacgtgaagcatcctctcatgcacgagtggaccctgtgg
ttcaccaagcctcctagcggcaagggcgataactggaacgacctgttgaaggaagttgtc
acatttaactcggttgaggaattctggggaatctacaacaacatcacgccgacctctgag
ttgggcctcaaagcagactaccatcttttcaaaaagggtatccggcctgagtgggaagac
cctcagaacaagcacggcggcaagtggtcgtattcgttcaaagacaagcgttctgtacct
atcgacgatctgtggctgcacgcccaactggcagccattggtgagactctcgaaaatgat
ggcgacagcgaggttatgggagtcgttgtgaatgtgcgtaagggtttctaccgtgtcggt
ctgtggacacggactgtgggcaagagcattccgggagacaagagttcccgcacacctgct
cagggcaaggacgttctcgaatccatcggccgccggttcaaggaagtcttgcgtctgaac
gaggcggacgttgtggagttctctggacacacagacagtgcacacagcggtagcacgagg
gcgaaggccaagtacactgtttga

DBGET integrated database retrieval system