KEGG   Aspergillus oryzae: AOR_1_4154Help
Entry
AOR_1_4154        CDS       T01018                                 

Gene name
AO090003000002
Definition
histone-lysine N-methyltransferase, H3 lysine-4 specific
Orthology
K11422  
histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
aor  Aspergillus oryzae
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    AOR_1_4154 (AO090003000002)
Enzymes [BR:aor01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     AOR_1_4154 (AO090003000002)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1229 aa AA seqDB search
MSRSSAGFADFFPTAPSVLQQKRFKVTRERPRPKAQIDSEHSDESSACPTETRAILNLSN
GGASLDSGQISSTDLKKTSPESSVEGSASSTAGDRSALSLSVAQHGANSHEARLDTLTPL
TNAESSPPQKANSPRNKIAEGIVANTTIDTKSGINPLHTPPTPQSQGRRTGSIRGYKLVY
DPDTEKRSSSKEKRRKPRYVDIILSEQNNCPPDPRLGIPNYMRGAGCKQKRKYRPAPYTL
KPWPYDASSTIGPGPPAQIVITGFDPLTPIAPISALFSSFGDIGEINNRTDPITGRFLGI
CSVKYKDSASFRGGGPVLAASAARRAYYECRKEQRIGTRRIRVDLDRDGVVSERFVARTI
ESQRMGQKSNLQSTEEVKSDSETKKNEPPPTAPKGPSGKTSVRPIVAIPEGPRANFLKPV
MPSLVEEVPILGQIKRDPYIFIAHCYVPVLSTTVPHLKKRLKLFNWKDIRCDKTGYYIIF
ENSRRGEEETERCYKMCHMKPLFTYIMNMESQPYGNPSYERSPSPERCRAEQRERAERER
LKREVGLDIEEEKRQRAVDLDPCQEVLTIIIRDLKDKLLEDVKSRIAAPALYDYLDPDRH
ALKRKTLGIADPEGIKRPMFRIDDSFGTPDSRSGLSDARRPFSGSTPNILALPRIRKARH
LGRTDTAFLDERRKQPLRRREVRPLYHRLQQLHDVDDSDDEQRTPKDTDEQDSRPPSRMS
SGTSESDDGDGFVSEALGLPVVELAGSGQNKEPDEILKDNQSVGESSQLESNEISPELRK
RKRASEELEARKRQKEDDELFGINPIAEAEVEGTQIIATPIAVDINLEVSEAALSILPKE
SNDNRQETGEANHLDFDGIDVTSSTIEKDRRGILDPLDDIDNAAAREESRTEVGWRVSND
EPRPIVDDDDAIIMDLDGWQNLIKDDEDLHFLRDILVGYSESNVGNLSAWAWRQKEIKAL
NHPGDVGPLRGGTGIAGYYVPNTTGAARTEGRKRILESEKSKYLPHRIKVQKAREEREAR
AKNDPHTAAVEAARVAAAKNISKSTSRSTRVNNRRLIADINAQKQALPTQSGDGDVLRFN
QLKKRKKPVRFARSAIHNWGLYAEENISANDMIIEYVGEKVRQQVADMRERQYLKSGIGS
SYLFRIDENTVIDATKRGGIARFINHSCTPNCTAKIIKVDGSKRIVIYALRDIERDEELT
YDYKFEREWDSDDRIPCLCGSTGCKGFLN
NT seq 3690 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgctcctcggcaggctttgcagacttcttccctactgcgccgtctgtcctccag
caaaaacgatttaaagtaactagggagcgaccgcgacctaaagcccaaatcgatagtgaa
catagcgatgaatcatcagcgtgccccacggaaacaagagctattctcaacctatctaat
ggcggtgcatctctggattcagggcaaatatcttctactgatttaaagaaaacgtcaccg
gaatcgtctgtcgagggctctgcaagttctacagcaggagatcgttcagcccttagctta
tctgttgctcagcatggcgcgaactcgcatgaagcgcgtcttgacaccctaactcctctt
accaatgcagaatcatcgcctcctcaaaaagcaaactcaccccggaataaaatagcagaa
gggattgttgcaaatactactatcgacactaaaagtggaataaaccctctccataccccg
ccaacaccacagtctcaaggccgtcgcactggaagcatcagaggttacaagctggtctat
gaccctgacaccgaaaaacgatcatcttcgaaggagaagcgaagaaaaccccgttatgtc
gatattattctgagcgagcaaaacaattgcccaccagatcctcgcctgggaatcccaaat
tacatgcgaggtgccggttgcaagcagaagaggaaatatcgaccagcgccctatacccta
aagccttggccttatgatgcctcatcgacaatagggcccggcccccctgcgcagatagtt
atcactggtttcgacccgctcactccaattgcgccgatcagcgccctgttctcgagtttc
ggggatattggcgagataaataaccgcacggatccgattactggcaggtttcttggaata
tgttcagtaaagtataaagacagcgcttcattccggggcggcggtcctgtccttgcagca
agcgcggccaggcgagcttactacgaatgcagaaaagagcagcgcattggaacacgaagg
atcagggttgacttggatcgcgatggggttgtctcagaaagatttgtggctaggacaatt
gagtcccagaggatgggacagaaaagcaatcttcaatctacagaagaggtgaaatctgat
tcggaaacaaagaaaaacgagcctcctccgacggcgccaaaaggtccttcaggaaaaacc
tcagttcgccctatagttgcaattcctgaaggaccgagggcaaattttcttaaacctgtc
atgccatctttggtcgaggaagtacccattttgggtcagatcaaaagggacccgtatatc
ttcattgcgcattgctacgtaccagtccttagtacaaccgttccgcaccttaagaagagg
ctcaagctgtttaactggaaagacattcgttgcgacaagaccgggtactatattatattc
gagaattctaggcgcggtgaggaggaaactgagcgctgctacaaaatgtgccacatgaag
cctttgttcacctatatcatgaatatggaaagccagccttatggcaatcccagctacgag
cgcagtccaagtcctgaacgatgtcgagcagaacaacgcgagcgagcagaaagagaaaga
ctgaaaagagaagtgggtcttgatatcgaagaagagaaaaggcagcgagcggttgacctt
gatccctgccaagaagtattaaccatcataattcgagacctgaaggataaacttcttgaa
gatgtgaagtcacgcattgctgcaccagccttgtatgattacctcgacccggaccggcat
gctctgaagaggaaaacgttaggtatcgctgatccagaggggatcaagaggcccatgttt
cgaattgatgattcgttcgggacaccagactcgaggtcagggttgtcagacgcaaggcgt
ccgttcagtggatctactccaaatattcttgcacttcctcgtattcgaaaggctcgtcat
cttggtcgcacagatactgctttcttggatgaaaggcgcaagcagccgctgcggagaaga
gaggtccgaccactgtatcaccgattacaacagttgcatgacgttgacgactcagatgat
gagcaacgaacaccaaaagatacggatgagcaagatagccggcccccaagtcggatgagc
tcagggacctcggagtctgatgatggcgacggctttgtttccgaggctttgggccttcca
gttgtagaactggctggctcaggtcaaaataaagagcccgatgagattctgaaagacaac
caatcggtaggcgaaagttcacagcttgaaagcaacgaaatctctccagagttacggaag
cggaaaagagccagcgaagaactcgaggcgcgcaagagacaaaaggaagatgacgaactt
tttggcattaatcctattgcagaagctgaagtcgaaggcacccaaatcatcgcaactcct
atagccgtggacataaatctcgaagtttcagaagctgctttgagtatccttccaaaagag
agtaatgataaccggcaagagactggagaagccaaccatctggactttgatggtattgat
gttacgtcctcgacgatagaaaaagaccgccgtggtatactagatcctcttgacgatatc
gataatgcggctgcgcgcgaagaatcccgaacagaagtgggatggcgagtgtcgaatgac
gagcctaggcccattgtcgatgacgacgacgcaataatcatggatctcgacggatggcag
aatctaattaaagacgatgaggatctgcactttcttcgagatattcttgttggatattcc
gagtccaacgttgggaatttgtcggcttgggcatggaggcagaaggaaatcaaagccctc
aatcatcccggagatgtggggcccctgcgcggagggactggcatcgcaggatattacgtg
cccaatacaacaggtgcagctcgaacagaaggaagaaagagaatattggagtcggagaag
tcaaaatacctgccacatcgtatcaaagtccagaaggcacgtgaagaacgagaggccaga
gcaaagaatgatccgcatactgctgcggttgaagctgcaagagttgctgcggcaaagaac
atctctaagtctacttccagatctacacgggtcaataaccgccgattgattgcagatatc
aatgcacagaaacaggctcttcccactcaatccggagacggtgacgtccttcgcttcaat
cagctgaagaaacgaaagaagccagtacgctttgctcggtcagctatccataattggggc
ctctacgcagaagagaatatatcagcaaatgacatgataattgaatatgtaggtgaaaaa
gtgcggcagcaggttgcggacatgagggagaggcagtaccttaagagtgggatcggcagc
agctaccttttccgcattgatgagaacacagttatagatgctacaaagagagggggcatt
gctaggtttatcaaccatagctgtacaccgaattgcactgccaagatcatcaaagtcgat
ggtagcaagcgtattgttatatatgccttgagagacatcgagagagatgaggagctgacg
tatgactacaaattcgaaagagagtgggacagcgatgataggatcccatgcctttgtggc
tcaaccgggtgcaaagggttccttaactga

DBGET integrated database retrieval system