KEGG   Aspergillus oryzae: AOR_1_460154Help
Entry
AOR_1_460154      CDS       T01018                                 

Gene name
AO090003000271
Definition
ubiquitin hydrolase
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
aor  Aspergillus oryzae
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:aor04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 1098 aa AA seqDB search
MSSDAAALPSPPGFAPWENIGHPGGQISRPDSLSSSNHATPAGYQSPRFSNIKDLQDEAA
ALDVNEDSSLNLLLNRAQDAIENARRFADNDQPDKAYVQYLRASEITINIIPHHPDYRTT
ASQRSDWYKQFANLMMAVRTKQGTMDDIKQQILEDNLRSNVQPTTVTEHNYSRPASELIP
AGTLRSLSPRGRQTEQGDKSTRMPSPSEFQRSLGLQERPNRYSAPAEDMLAQRFAKLRAS
PPATNDSFSTIKGQNTTQSHNGDIPRRPLSYMPQGSPYSPNLASPSRRPLGPRSMGPSHN
GPVLPPKVPLDTSLPRAPDPAYSPIWTVPSQPPSNPPRTSTEISRPVNPRYSHLANSPRG
SPSRNGFDDNPYRSRTPNGIHQLKEDRSNTADLPHSTAISAQDLLDYLRRYNVLLIDVRP
RDQYDSGHVYAKSIICIEPVALKENVSAEELEERLVVSPEHEQSLFEKRNEFDMIVYYDQ
STDSVSYLAGSPVGTTAPHLRALYDTLYEFNAYKPLKDGRPPALLLGGLDAWIDLLGQQS
LATSSTATVLGSLQKKRPVARPGRPLGRVPTMVSANSSLEVRKRRLREYKPLNPDELTAW
MEKSKNEEIDTTTYIEEEPMAEEPEGQETNEPPTPFVHTYEDFLRRFPEPHAIQESMVTP
HARPPVPPMPNYAAPVPVAPSRPPPAVPRPSYSGVTDGRQIQPTLARQNSATKTALYTPS
SIYRAKLPRTGLANFGVTCYMNSTIQCLNATMMLSRFFVDNRFRYYVQKNWKGSQGVMPG
LFANLIRSLWKGDVEVIVPTSFRNFCGRLNQEWAIDRQQDAKEFFDFTVDCLHEDLNINW
QRSPLRPLTFEEEMQRERMPVAKVSKIEWDRYCHREESFISSLFAGQHASRLRCTTCKRT
STTYEAFYSISVEIPSSGTGDIYQCLRSYCKEEMLSGDEVWKCPYCKCERVATKQIIITR
APQILVIHFKRFSASKTQTARKIHTPIEFPLHGLRMDDFVYSPPSPESNGDPKATMPHDT
TLATVPPFTYDAYGVLRHIGSSMSSGHYISLVRDGARQCWRRFDDERTVDFNPRDLRNKD
RLQNEQAYIVFYERVPAK
NT seq 3297 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcagatgcagccgctttgccctctccaccgggttttgcgccgtgggaaaatatc
ggccaccctgggggccaaattagcagaccagattcgctttcgagcagcaaccatgccact
ccagccggttatcaatctccacgattttctaatatcaaggaccttcaagacgaagcagcg
gccctggatgtgaatgaggattcttcactcaacctccttctcaacagagcccaagacgca
atagaaaatgctaggagatttgctgataacgaccaaccggacaaagcttacgttcagtac
cttcgggcttccgagatcactatcaacatcatacctcaccacccagattatcgaacgact
gccagccagcgctcagattggtacaagcagttcgcaaatttaatgatggctgtgcggaca
aagcaagggactatggacgatatcaagcaacaaatcttggaagacaatctcagaagcaat
gtacagcctacgactgtaaccgaacataattattcaagacctgcttcagagctaatacct
gctggtacgcttcgaagcctcagtccaagaggtcgtcaaaccgaacaaggtgataagtca
acacgaatgcctagcccgtcggagtttcagcggtcgttgggtttacaagagagaccgaat
agatactcggcgcctgcagaagatatgttggcccagcggttcgccaaactaagagcatca
ccgcccgctacgaatgactcgttctcaacaattaaaggtcaaaatactacgcagagccat
aatggcgatattcctagacggccgttgtcttatatgcctcaagggtcgccgtatagcccc
aaccttgcttcaccctcgcggcggcctctagggccccgaagcatggggccatcacataat
ggtccggtcctgcctcccaaagtccccctcgatacgtcgcttcctcgtgcaccagatcca
gcttatagtccaatctggacagtcccatctcagccgccttcaaacccgcctaggacctca
accgaaatctcccgtccagtcaacccccgatactcccatctcgctaattcaccccggggc
agcccaagtcgtaatggcttcgacgacaatccttataggtcacggaccccgaatggaatt
caccagttgaaggaagacagaagtaacactgccgatttgccacacagcactgccatcagc
gcccaagacctactcgactatctccgaagatataacgtgttattgatcgacgtgcgcccc
cgggatcagtacgatagtggacatgtgtacgcgaaatcaatcatctgcatcgaaccagtg
gccctgaaagaaaacgtatcggcggaggagcttgaggagcgtttagtagtgtcgcctgag
catgaacagtctctattcgagaaacggaacgaatttgacatgatagtctactatgaccag
tccaccgattcagtcagctacctcgccggatcccctgttggaacaacagcgccacatctt
agggctctctatgatacactatatgaatttaatgcctataaacctttgaaggacggtcgt
cctccggctcttttgctgggtggccttgatgcatggatcgatctccttgggcaacaatcc
cttgccacatcctccacagctactgtgctaggttcgctccagaaaaagcgcccagtcgcg
agacccggccgacctcttgggagagttcctactatggtgagcgctaattctagcttggaa
gtgaggaagagacggctacgcgaatataaacccttgaatccagacgagctcaccgcatgg
atggaaaagtcaaagaacgaagaaattgacaccacgacatatatcgaagaggagccaatg
gccgaggagcccgagggacaagagacaaatgagcctcctacgccattcgtgcatacctat
gaagacttcctacggcgcttcccggagccccatgctatccaagaatcaatggtgacgcca
catgcccggccaccagtaccgcctatgcctaactatgctgctcctgtccctgttgctccc
tcccgacctccacctgcggttccacggccaagttatagcggtgttaccgatggccggcaa
atccagcctacattggcgcggcagaattctgctaccaagactgccctctacactccaagt
tcaatatatcgcgcaaagttgccgagaactggtcttgctaattttggtgtaacttgctat
atgaactcaacaatacaatgcttgaatgcgacgatgatgttgagtagattttttgttgat
aacagatttcgatactatgtgcagaagaactggaaaggctcacagggagtcatgccgggg
ctttttgccaatctcataaggtccttgtggaagggtgatgtggaagtcattgttcctact
tcgtttcgaaacttctgcggaaggctaaaccaggaatgggccatcgatcgacagcaggat
gccaaagaattctttgacttcactgttgattgtctacacgaggatttaaacattaattgg
cagagaagcccattgaggccgctgacatttgaagaggagatgcagcgggagagaatgcct
gttgccaaagtctcaaagattgaatgggatcggtactgtcaccgagaagagtccttcatt
tcttcgctttttgctggtcaacatgctagccggctccgttgtacaacgtgcaagcggaca
tccacgacgtacgaggctttctacagcattagcgttgaaattccgtcgtccgggactggt
gatatctatcaatgtctgcgcagctattgtaaagaagagatgttgagtggcgacgaggtg
tggaagtgtccttactgcaaatgcgaaagggttgcaacgaagcagattattatcacgcgg
gctccgcaaatcttggtgattcatttcaagagattctcagcgtcgaagacacaaaccgct
cggaagattcacactcctattgaatttcctttacatggtctgcggatggatgattttgtt
tattcaccgccaagcccggagtcgaatggtgatcccaaggcaacgatgccacacgatact
accctggcgactgtacccccgtttacgtacgatgcatatggtgtgctacgccatattggg
tcgtctatgagcagcggacattacatatctttggtgcgagacggtgcgcggcagtgttgg
cggagattcgatgatgagcgaactgtcgatttcaatcctcgcgatctgcgaaacaaagac
cgactgcagaacgaacaagcatacattgtattctatgagcgcgttcccgcgaaatga

DBGET integrated database retrieval system