KEGG   Aspergillus oryzae: AOR_1_460154Help
Entry
AOR_1_460154      CDS       T01018                                 

Gene name
AO090003000271
Definition
ubiquitin hydrolase
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
aor  Aspergillus oryzae
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:aor00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    AOR_1_460154 (AO090003000271)
Enzymes [BR:aor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     AOR_1_460154 (AO090003000271)
Peptidases [BR:aor01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   AOR_1_460154 (AO090003000271)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 1098 aa AA seqDB search
MSSDAAALPSPPGFAPWENIGHPGGQISRPDSLSSSNHATPAGYQSPRFSNIKDLQDEAA
ALDVNEDSSLNLLLNRAQDAIENARRFADNDQPDKAYVQYLRASEITINIIPHHPDYRTT
ASQRSDWYKQFANLMMAVRTKQGTMDDIKQQILEDNLRSNVQPTTVTEHNYSRPASELIP
AGTLRSLSPRGRQTEQGDKSTRMPSPSEFQRSLGLQERPNRYSAPAEDMLAQRFAKLRAS
PPATNDSFSTIKGQNTTQSHNGDIPRRPLSYMPQGSPYSPNLASPSRRPLGPRSMGPSHN
GPVLPPKVPLDTSLPRAPDPAYSPIWTVPSQPPSNPPRTSTEISRPVNPRYSHLANSPRG
SPSRNGFDDNPYRSRTPNGIHQLKEDRSNTADLPHSTAISAQDLLDYLRRYNVLLIDVRP
RDQYDSGHVYAKSIICIEPVALKENVSAEELEERLVVSPEHEQSLFEKRNEFDMIVYYDQ
STDSVSYLAGSPVGTTAPHLRALYDTLYEFNAYKPLKDGRPPALLLGGLDAWIDLLGQQS
LATSSTATVLGSLQKKRPVARPGRPLGRVPTMVSANSSLEVRKRRLREYKPLNPDELTAW
MEKSKNEEIDTTTYIEEEPMAEEPEGQETNEPPTPFVHTYEDFLRRFPEPHAIQESMVTP
HARPPVPPMPNYAAPVPVAPSRPPPAVPRPSYSGVTDGRQIQPTLARQNSATKTALYTPS
SIYRAKLPRTGLANFGVTCYMNSTIQCLNATMMLSRFFVDNRFRYYVQKNWKGSQGVMPG
LFANLIRSLWKGDVEVIVPTSFRNFCGRLNQEWAIDRQQDAKEFFDFTVDCLHEDLNINW
QRSPLRPLTFEEEMQRERMPVAKVSKIEWDRYCHREESFISSLFAGQHASRLRCTTCKRT
STTYEAFYSISVEIPSSGTGDIYQCLRSYCKEEMLSGDEVWKCPYCKCERVATKQIIITR
APQILVIHFKRFSASKTQTARKIHTPIEFPLHGLRMDDFVYSPPSPESNGDPKATMPHDT
TLATVPPFTYDAYGVLRHIGSSMSSGHYISLVRDGARQCWRRFDDERTVDFNPRDLRNKD
RLQNEQAYIVFYERVPAK
NT seq 3297 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcagatgcagccgctttgccctctccaccgggttttgcgccgtgggaaaatatc
ggccaccctgggggccaaattagcagaccagattcgctttcgagcagcaaccatgccact
ccagccggttatcaatctccacgattttctaatatcaaggaccttcaagacgaagcagcg
gccctggatgtgaatgaggattcttcactcaacctccttctcaacagagcccaagacgca
atagaaaatgctaggagatttgctgataacgaccaaccggacaaagcttacgttcagtac
cttcgggcttccgagatcactatcaacatcatacctcaccacccagattatcgaacgact
gccagccagcgctcagattggtacaagcagttcgcaaatttaatgatggctgtgcggaca
aagcaagggactatggacgatatcaagcaacaaatcttggaagacaatctcagaagcaat
gtacagcctacgactgtaaccgaacataattattcaagacctgcttcagagctaatacct
gctggtacgcttcgaagcctcagtccaagaggtcgtcaaaccgaacaaggtgataagtca
acacgaatgcctagcccgtcggagtttcagcggtcgttgggtttacaagagagaccgaat
agatactcggcgcctgcagaagatatgttggcccagcggttcgccaaactaagagcatca
ccgcccgctacgaatgactcgttctcaacaattaaaggtcaaaatactacgcagagccat
aatggcgatattcctagacggccgttgtcttatatgcctcaagggtcgccgtatagcccc
aaccttgcttcaccctcgcggcggcctctagggccccgaagcatggggccatcacataat
ggtccggtcctgcctcccaaagtccccctcgatacgtcgcttcctcgtgcaccagatcca
gcttatagtccaatctggacagtcccatctcagccgccttcaaacccgcctaggacctca
accgaaatctcccgtccagtcaacccccgatactcccatctcgctaattcaccccggggc
agcccaagtcgtaatggcttcgacgacaatccttataggtcacggaccccgaatggaatt
caccagttgaaggaagacagaagtaacactgccgatttgccacacagcactgccatcagc
gcccaagacctactcgactatctccgaagatataacgtgttattgatcgacgtgcgcccc
cgggatcagtacgatagtggacatgtgtacgcgaaatcaatcatctgcatcgaaccagtg
gccctgaaagaaaacgtatcggcggaggagcttgaggagcgtttagtagtgtcgcctgag
catgaacagtctctattcgagaaacggaacgaatttgacatgatagtctactatgaccag
tccaccgattcagtcagctacctcgccggatcccctgttggaacaacagcgccacatctt
agggctctctatgatacactatatgaatttaatgcctataaacctttgaaggacggtcgt
cctccggctcttttgctgggtggccttgatgcatggatcgatctccttgggcaacaatcc
cttgccacatcctccacagctactgtgctaggttcgctccagaaaaagcgcccagtcgcg
agacccggccgacctcttgggagagttcctactatggtgagcgctaattctagcttggaa
gtgaggaagagacggctacgcgaatataaacccttgaatccagacgagctcaccgcatgg
atggaaaagtcaaagaacgaagaaattgacaccacgacatatatcgaagaggagccaatg
gccgaggagcccgagggacaagagacaaatgagcctcctacgccattcgtgcatacctat
gaagacttcctacggcgcttcccggagccccatgctatccaagaatcaatggtgacgcca
catgcccggccaccagtaccgcctatgcctaactatgctgctcctgtccctgttgctccc
tcccgacctccacctgcggttccacggccaagttatagcggtgttaccgatggccggcaa
atccagcctacattggcgcggcagaattctgctaccaagactgccctctacactccaagt
tcaatatatcgcgcaaagttgccgagaactggtcttgctaattttggtgtaacttgctat
atgaactcaacaatacaatgcttgaatgcgacgatgatgttgagtagattttttgttgat
aacagatttcgatactatgtgcagaagaactggaaaggctcacagggagtcatgccgggg
ctttttgccaatctcataaggtccttgtggaagggtgatgtggaagtcattgttcctact
tcgtttcgaaacttctgcggaaggctaaaccaggaatgggccatcgatcgacagcaggat
gccaaagaattctttgacttcactgttgattgtctacacgaggatttaaacattaattgg
cagagaagcccattgaggccgctgacatttgaagaggagatgcagcgggagagaatgcct
gttgccaaagtctcaaagattgaatgggatcggtactgtcaccgagaagagtccttcatt
tcttcgctttttgctggtcaacatgctagccggctccgttgtacaacgtgcaagcggaca
tccacgacgtacgaggctttctacagcattagcgttgaaattccgtcgtccgggactggt
gatatctatcaatgtctgcgcagctattgtaaagaagagatgttgagtggcgacgaggtg
tggaagtgtccttactgcaaatgcgaaagggttgcaacgaagcagattattatcacgcgg
gctccgcaaatcttggtgattcatttcaagagattctcagcgtcgaagacacaaaccgct
cggaagattcacactcctattgaatttcctttacatggtctgcggatggatgattttgtt
tattcaccgccaagcccggagtcgaatggtgatcccaaggcaacgatgccacacgatact
accctggcgactgtacccccgtttacgtacgatgcatatggtgtgctacgccatattggg
tcgtctatgagcagcggacattacatatctttggtgcgagacggtgcgcggcagtgttgg
cggagattcgatgatgagcgaactgtcgatttcaatcctcgcgatctgcgaaacaaagac
cgactgcagaacgaacaagcatacattgtattctatgagcgcgttcccgcgaaatga

DBGET integrated database retrieval system