KEGG   Aspergillus oryzae: AOR_1_486094Help
Entry
AOR_1_486094      CDS       T01018                                 

Gene name
AO090120000280
Definition
repressible alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
aor  Aspergillus oryzae
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AOR_1_486094 (AO090120000280)
Enzymes [BR:aor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     AOR_1_486094 (AO090120000280)
Exosome [BR:aor04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AOR_1_486094 (AO090120000280)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 606 aa AA seqDB search
MARDEPLLAPRPSSDHSSIRNAEEEDALLTGERTHREQQRSKWAFWKDVGLFSWAFIATI
AVIVLAVVYQHETSKNHSAKQPWGPGGKPTGKRNLIFMVSDGMGPTSLTMTRNYRQFTEG
LPVDQTLVLDDHIIGTSRTRSSNSLVTDSAAGATAFSCAHKSYNGAISVLPDHSPCGTVL
EAAALAGYKTGLVVTTRITDATPACFASHVNLRGYEDRIAEQEIGEHPLGRVVDLMFGGG
RCHFLPNSTEGSCRGDDRDLIEIAGQKGFHYLNDRKAFDSLNGGSEAKLPLLGLFAEKDI
PYEIDRRSQDGVYPSLEEMTRTALKTLSQATADSDKGFFIMIEGSRIDHAGHGNDPAAQV
HEVLAYDRAFAAVLEFLEQDSTPGVVVSTSDHETGGLAAARQLHDAYPEYKWLPGVLANA
SHSSEFAGATLREYLSKNPDAKSQRKFVHELLEKSLGVFDATDEEIDHLLDPKLPYTNNY
VFADIISRRAQIGWSTHGHSAVDVNIYASSTKDAWRLVGNNENTDVGAFLSDYLEVDVED
VTRRLQTPSEWTWKPEVEPSTSTSLSWLGDPLGEAVRTDGLDTYHGEFKKRSMDLETREC
GCGELH
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgagacgagccccttttggctccgcgcccctcctccgaccactcctcgattcgg
aatgcagaagaagaggacgccttactaacaggcgagcgcacccaccgtgaacagcaacgc
agcaaatgggccttctggaaagacgtcggtctcttttcctgggcgttcattgctaccatt
gccgtgatcgtcctcgccgtggtttaccaacatgagacgagcaaaaaccatagcgcgaag
caaccttggggccccggaggcaagccgaccggcaagcggaacttgatcttcatggtctcc
gacggaatgggacccactagtttgactatgaccagaaactatagacaattcacggaggga
ctgcccgtggatcagacactcgtgctggatgaccacatcattggtacttctagaacgagg
tccagcaacagccttgtcactgattcggcagccggtgctactgccttctcgtgtgcccat
aagagctacaatggagctatctccgtgctgcctgaccactcgccttgtggaactgtgctt
gaggccgctgccttggctggttataagaccggcttggtcgttaccactcggattacggat
gctacccctgcctgttttgcttcgcatgtcaaccttcgcgggtatgaggatcgtattgcg
gagcaggagatcggtgaacacccgctgggccgtgtggtggatttgatgttcggtggtgga
cgatgccatttcctccccaactcaacggaaggcagctgccgtggtgatgaccgggacttg
atagagatcgctggccaaaagggcttccactacctgaatgaccggaaggccttcgattcc
ctgaacggcggctcggaagccaagctgccgctcctgggtctcttcgcggagaaggatatt
ccctatgaaattgaccgtcgcagccaggatggcgtgtacccatccctggaagaaatgacc
cgtaccgcactcaagactctcagccaagccaccgcggacagcgacaagggtttcttcatt
atgatcgaaggctcccgcatcgaccacgccggacacggaaacgaccccgcagcacaggtt
cacgaagtcctagcctacgaccgggccttcgcagccgtccttgagttcctggagcaagac
tctaccccaggagtagtggttagtacctctgatcacgaaacgggcggtctggccgcggct
cgacagctgcatgacgcttatccggagtacaaatggctgccaggcgtcctggccaacgcc
agccattcctctgagtttgccggtgcaacgctcagggaatacctctccaagaacccggat
gccaagtctcagcgcaaattcgttcacgaactcctggagaaatccctgggcgttttcgac
gcgacggatgaggaaatcgaccatcttcttgaccccaagctgccttatacgaacaactac
gtgtttgccgatatcatcagtcgtagggcgcagattggttggtccacgcatggacattcg
gccgttgacgtgaacatctacgcctcctccaccaaagacgcctggcgtctggtgggcaac
aacgagaacacagacgtcggagccttcctctccgactatcttgaagtagacgtagaagac
gtcaccaggcgccttcaaactcctagcgagtggacatggaagcctgaagtcgaaccctcc
acctccacatctctcagctggttgggagaccccttgggcgaggccgtccgcaccgatggt
ttggatacctaccatggagaattcaagaagcgctccatggacttggaaacgagggaatgt
ggctgcggtgagctgcattga

DBGET integrated database retrieval system