KEGG   Aspergillus oryzae: AOR_1_500074Help
Entry
AOR_1_500074      CDS       T01018                                 

Gene name
AO090038000300
Definition
histone-lysine n-methyltransferase, suv9
Orthology
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
aor  Aspergillus oryzae
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    AOR_1_500074 (AO090038000300)
Enzymes [BR:aor01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     AOR_1_500074 (AO090038000300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 455 aa AA seqDB search
MPVKMVIDLTGDSDSEDQIRSQRKPSAPSVESSAASSSVPHQNNLPNGSTIATTKLQSST
PSPSPVIKEQSLPARAISVVVPSPSSQLKKEIESAKWASSSQSCTPELKGVLEKFYPTNA
HVERGRKGAYPAARKVNRAAIPLPTGTPGPILQKRPEALDQQYRTLERKLSTIKGPKITF
APADGPKLAKVTANFQFINSYKLHKGVSPAPAEFIGGCSCGKHCDPERCPCSEKEDDSTE
NIIPYQRAKDRPDLLVLTPEFLRRTAMIFECGAQCACDKSCWNRVVQRGRTVELEIFYTG
NRGFGLRSPRYIREGQFIDCYLGEVITKQHADIREETAVKNGHSYLFGLDFSPEVDEEDI
YVVDGQRFGCATRFMNHSCKPNCRMFTVTNTIGDERLYNLAFFALKDIPPMTELTFDYNP
GTERSEKVDSSVVACLCGEDNCRGQLWPSKRKGTK
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgccggtcaagatggttatcgatttgacaggagattctgattctgaagaccagatccgc
tcgcagagaaagccttctgcgccctcagtggaatcctctgcggcttcaagttctgtcccc
catcagaacaatctgccgaatggcagtaccatagctactacaaagctccaatctagcacc
cctagcccgagtccggtcattaaggagcagagtctgccggcacgggccatcagtgttgta
gtcccttctccatcgtcacagctgaagaaggaaattgagtctgccaagtgggcatcaagc
tctcaaagttgtacccctgagctgaagggagtcctggagaaattctatccaactaacgca
catgtagagcgcggtcgcaagggtgcttatccagcagcgaggaaagtcaaccgtgctgca
atccctctgcctactggcacacccgggcccatcttacagaagagaccagaggcccttgac
cagcaataccgtactctggaacgcaagctttctacgatcaagggacctaagatcacgttt
gcgccagctgatggaccaaagctcgcaaaggtgaccgctaattttcagttcattaatagc
tataaacttcacaaaggggtttcccctgctccagctgaattcattggaggctgcagctgt
ggtaaacactgtgatcctgagaggtgcccctgctctgaaaaggaggatgattcaactgag
aacatcattccgtaccaaagagctaaggaccgcccagacctgctagtcctgactccagaa
ttcctgaggcgcaccgcaatgattttcgaatgtggtgcgcagtgtgcctgcgataagagc
tgttggaatcgggttgttcagcgtggcaggactgtggaattggaaattttctatactggc
aatcgtggctttggcctccggtctcctagatacatcagagagggccaatttatcgactgc
tacctaggagaagttattaccaaacaacacgcagatattcgcgaagagactgccgtgaaa
aatggccattcctatctctttggactcgacttctctcccgaagttgatgaagaagacatc
tacgtcgtcgatggacagaggttcggctgtgcaactcgtttcatgaaccactcctgcaaa
ccaaactgccggatgttcaccgtcacaaacaccatcggagacgagcgtctctataacctg
gctttcttcgccttgaaagatatcccaccgatgaccgaattgacgtttgattacaaccct
ggcacagagagaagcgaaaaagtcgactctagtgtcgtcgcttgcctgtgtggagaggat
aactgtcgaggtcaactctggccgagcaaacgcaagggcaccaaataa

DBGET integrated database retrieval system