KEGG   Aspergillus oryzae: AOR_1_500174Help
Entry
AOR_1_500174      CDS       T01018                                 

Gene name
AO090005000279
Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
aor  Aspergillus oryzae
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:aor00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 626 aa AA seqDB search
MVYTSTLLSLLALSTGTWASYNANLNYRSPSTRHTGMGINIDSVHRRSLAKRDEAPFHPS
QLNFTHGVASGDPYADSVILWTRVAPSLEADRSNVTVSGTVGLYNHDTESYIKASAHPIC
VDYRVYEDKEGRRVVDKGRAYTTSDIDYTLKVEASGLKPFTTYWYQFQICNSNVTSPLGR
TKTAPGADDATEEINLAVYSCSNYPNGYFNAYGNAVRKDSVDYVLHLGDYIYESKKGVVG
QDERAVRPEREIFSLYDYRTRLGHYRTDLDLAASHQNFAWIPVWDDHEIADNGYRDGFSR
LNNTEESFRNDSPQISVDQRKMNAVRAYFEWMPLRQVDMDDGLRIWRSFKMGNLFDLIML
DTRNYDRSITDLYWNTDYIEEIHNDAGRTLMGGRQESWFEKQLTASNQRGAKWRIIGSQL
RFARLGRETNGEVTYNMDSWEGYRANQNRTLKHLYDNNIGNNIMIAGDTHVNWVSDIAWI
GEKPYDGNTGVGAIGVEFAGTAVSSSGFGGTINSAEQTAASYARNEDLQWNEGYYRGYFE
LRMRQDEVEAKYFGCPTVATRNSWEIPLANFTVKHDDNHLSRPIAGGQVEAGFVHQGEVK
HSNLTLNTDTGEWQVIGFDQMFVKYQ
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atggtgtacacatcgaccctcctctccttactcgccctatccacagggacgtgggcaagc
tacaatgcaaacctaaactaccgcagcccttcaacccgccacaccggcatgggaatcaac
atcgactccgtccaccgtcgtagtctcgcaaaacgcgatgaagcccccttccacccctcg
cagttgaacttcacccatggtgtagcatctggtgacccctacgcggacagtgtgatcctc
tggactcgggtcgctccatccctggaggctgacagaagcaatgtgactgtttcggggacc
gtggggttgtacaatcatgatacagaatcgtatatcaaggcctcggcgcatcctatctgt
gtcgattatcgggtgtatgaggataaagagggccggagggtggttgataaagggagggct
tatacgaccagtgatattgattatactctgaaggtagaggctagtggattgaagccgttc
acgacgtactggtatcagttccagatttgtaactcgaatgtgactagtccgcttggacgg
accaagaccgccccgggtgccgatgatgctactgaggagattaacttggctgtttattct
tgcagtaattacccgaatggatatttcaacgcgtatggaaatgccgtccggaaggacagc
gtcgactatgtgctccaccttggagattacatttatgaatctaagaagggtgtggtcgga
caggatgagagagctgttcgaccggagcgagagatcttctccctctatgattatcggact
cggcttggacattatcgcactgatctcgaccttgccgcatcccatcagaactttgcctgg
atccctgtctgggatgatcacgaaatcgccgacaacggctacagagacggtttcagccgt
ctcaacaacacagaagaatctttccgcaatgacagccctcaaatcagcgtcgaccagcgc
aagatgaacgccgtccgggcgtactttgagtggatgcctcttcgtcaagtcgacatggat
gacggtctccgcatttggcgctctttcaagatgggaaacctctttgatttaatcatgttg
gatactcggaattacgatcgcagcattactgacctttattggaatacggattatatcgaa
gagatccacaacgatgccggtcggaccctgatgggaggtcgtcaggagtcgtggttcgag
aagcagttgacggcgtctaatcagcgcggcgcgaagtggcgtattatcgggagtcagctc
cgttttgctcgtttgggacgggagactaatggcgaggttacttataacatggattcttgg
gagggctaccgtgcgaaccaaaaccgcacgctcaagcacctgtatgataacaacatcggc
aacaatattatgatcgcgggcgatacacatgtcaactgggtgagcgacattgcctggatc
ggtgagaagccttatgacggcaacaccggtgttggtgccatcggagtcgaatttgctggt
acagcggtcagcagctccgggtttgggggaacgatcaacagcgcagagcaaactgctgct
tcttatgcgagaaacgaggatctgcagtggaatgaaggctactaccgcgggtactttgag
ctgcggatgagacaggacgaggtggaggcgaaatactttggatgccctactgtggctacc
cggaatagctgggaaattcctctggccaactttaccgtcaagcatgacgataaccatctg
agtcggcctattgctggtggacaggtggaagcgggttttgtccatcagggcgaggtgaag
cacagtaaccttacgctgaacactgacacgggcgagtggcaagtcattgggtttgatcag
atgtttgtcaaatatcagtag

DBGET integrated database retrieval system