KEGG   Aspergillus oryzae: AOR_1_506014Help
Entry
AOR_1_506014      CDS       T01018                                 

Gene name
AO090026000267
Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
aor  Aspergillus oryzae
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    AOR_1_506014 (AO090026000267)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 112 aa AA seqDB search
MGKDAGFAPGDSAKGAKLFQTRCAQCHTVEKDGANKVGPKLHGLFGRQTGSVDGYAYTDA
NKQAGVTWDENTLYSYLENPKKYIPGTKMAFGGLKKAKERNDLITYLKESTA
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggacgctggttttgctcctggtgactctgccaagggtgccaagctcttccag
actcgctgcgctcagtgccacactgtcgagaaggacggtgccaacaaggtcggccccaag
ctccacggtctctttggccgtcagaccggttccgttgatggctatgcctacaccgatgcc
aacaagcaggccggtgtcacttgggatgagaacactctgtactcctacctcgagaacccc
aagaagtacatccccggtaccaagatggccttcggtggtctcaagaaggctaaggagagg
aacgacctcatcacttacctcaaggagagcactgcttaa

DBGET integrated database retrieval system