KEGG   Aspergillus oryzae: AOR_1_512074Help
Entry
AOR_1_512074      CDS       T01018                                 

Gene name
AO090038000306
Definition
sphingosine kinase (SphK)
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
aor  Aspergillus oryzae
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:aor00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 502 aa AA seqDB search
MTSPSNGPSSNHADQPDSQRLLQHDSTLTVAQSVSLSIGGDSLLVVDERPKSKDQRACCG
LLTKSSKTTHSIGLYNILDADLSPAGLTITYAQAATKGSISVAALEYPISEKEKANAQTW
VSRLLDLAYGEAQRYKRLKVLINPFGGKGAASKIYHKHAAPVFAAARCVVDVQQTTHRGH
ATEIVEQIDIDAYDAIVCCSGDGLPYEVFNGLGKKPNAGEALAKVAVAMVPCGSGNAMAW
NLCGTGNVSVAALAIVKGLRTPMDLVSLTQGNTRTLSFLSQSFGVIAESDLGTDNIRWMG
AHRFTYGFLVRIMQRTVYPCDLAIKVEIDDKRAIKDHYNTYAHNPAPRRSPEETAGQSKG
LPELRYGTVQDDLPKDWEVVPGEEMGNFYAGKMAIVSKDTNFFPASVPNDGLMDIVTING
TLPRTTTLKMMTAIPENEFFDMPDVKIRKAAAYRLVPRQKEGYISVDGESIPFEALQAEV
HKGLGTVLSKSGHLYEAEGPRP
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgacttctccctccaatggcccttcttccaatcatgcggatcagccggattctcaacga
ttgctgcagcacgattcaaccttaacggttgcacaatcggtttctctttccatcgggggt
gactcccttctcgttgtcgacgagcgcccaaagtcaaaagatcagcgcgcatgttgtggc
ttgttgaccaagtcatctaaaactacccattccattgggctatataatattcttgatgcc
gatctttcccctgcgggcctaactatcacctatgcccaagccgctaccaaaggcagcatc
tctgtggctgcccttgagtacccgatcagtgagaaagaaaaggcaaatgcgcagacgtgg
gtttcgcgactgttagaccttgcatatggcgaagcacaacggtataagagacttaaagtt
ttaatcaacccatttggcggtaaaggtgcagcttctaagatctatcacaaacatgcagca
ccggtcttcgccgctgcgcgctgtgtggttgatgtgcagcaaacaacacatcgaggccac
gccaccgagatcgtggagcagatcgacatcgatgcctatgatgctatcgtttgctgttcc
ggtgatggtttaccgtatgaggtcttcaatggtctcggaaagaaaccgaatgctggagaa
gcactggcaaaagtagccgtcgccatggttccctgcggctctggtaatgccatggcatgg
aacctttgtgggacgggcaatgtttcagtggcagcgcttgcgattgtcaaaggcttgaga
acgcctatggatctggtctcgcttacgcaagggaacactcggactttgtcgttcctgtct
caatccttcggtgtcatcgcggaatcggaccttggaaccgacaacatccgatggatgggg
gctcaccgtttcacgtacggtttccttgtacgcatcatgcaacggacggtgtacccatgc
gacctcgccatcaaagtggagattgatgataaaagagcgatcaaagaccattacaataca
tacgcacacaacccagctccgcgccgttcccccgaagagactgcaggacagtccaagggt
cttcccgagcttagatacggcacggtccaggatgatcttcccaaagattgggaagttgtt
ccaggagaagaaatgggcaacttttacgcaggcaaaatggctattgtatccaaggacaca
aatttcttccctgcctccgtgcccaacgatgggttaatggacattgtcactatcaacgga
acacttccccgtactacgaccctcaagatgatgactgccatccctgagaatgagttcttt
gatatgcccgatgtcaagatccgcaaagctgctgcctaccgcctggtccctcgtcagaag
gaaggttatatcagcgtcgacggtgaaagcatcccgttcgaagctctccaggctgaagtc
cataaaggtctcggtacagtgctttctaaatcgggacatctttatgaggcagagggcccg
agaccgtaa

DBGET integrated database retrieval system