KEGG   Aspergillus oryzae: AOR_1_518114Help
Entry
AOR_1_518114      CDS       T01018                                 

Gene name
AO090701000281
Definition
cyclin Ccl1
Orthology
K06634  
cyclin H
Organism
aor  Aspergillus oryzae
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:aor00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    AOR_1_518114 (AO090701000281)
  Replication and repair
   03420 Nucleotide excision repair
    AOR_1_518114 (AO090701000281)
Transcription machinery [BR:aor03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     AOR_1_518114 (AO090701000281)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 422 aa AA seqDB search
MIEDDFYRSSSQFRLWSYTEASLQSLRATTNANASERVRSALRKSREAQQSATSSAAGTP
AANQNGSDADSKAGGEETEIECLTPEEEHQLVRYFCEQIIELGEMYKPPLPTIVRATAIQ
YLRRFYLTNSPMTYHPKSIMLCALFLATKTDNYYLSLRQFAEVIPGGTTPEDIIQPEFLV
MQSLRFTFDVRHPFRGLEGGIMELQAISQGMGQPAPHFPTQTPDDLKRKLHSLPASPTTS
SSSITNRLARAHHNTREILKSAAQMTDAYFLYTPSQIWLAAFMIADKPLAEFYLETKLGG
PQQQQQGSPLYELRTKLLRTLTDCSHLLQAYKPLASDPDQKKNLRRIRKKLTHCQNPDKA
GVAGQKRIPAAAAAVAAAGDPATSESEMERLAKKRKLDGGQPNDIFGGELVTQRTKEAQQ
PQ
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaagacgatttctatcgctcctcatcccagttccgactttggtcctacacagag
gcatctttacaatccctacgcgcaacgacaaacgcaaacgccagtgagcgagtacggtcc
gcactccgaaaatcgcgagaggcgcaacaatcagccacctcatccgcagcgggaacacca
gcagcaaaccagaatggaagcgacgcagacagcaaagcaggcggcgaagagacggagatc
gagtgcctaacacctgaagaagagcaccagctggtgcgatacttctgcgaacagatcata
gagttaggggagatgtacaaacctccactcccaacaatagtccgggccacagcaatccaa
tacctccgacgcttctacctaaccaactccccaatgacctaccacccgaaatcaatcatg
ctctgcgccctcttcctcgccacaaaaacagacaactactacctctccctccgccaattc
gcagaagtaatccccggcggcacaacaccggaagacataatccagcctgagtttctggtc
atgcaaagcctccgcttcacgttcgacgtccggcaccccttccgcggcctcgaaggcggc
atcatggaactccaagccatatctcaaggcatgggccaaccagcaccacacttcccaacc
cagacaccagatgacctcaaacgcaaactccattccctccccgcatcaccgactacatcc
tcatcctccatcacaaaccgacttgcccgcgcgcaccacaacacccgcgagatcctcaaa
tccgccgcccaaatgacagacgcttacttcctctacacgccgtcccagatctggctcgct
gcgttcatgatcgcagataagccgctagcggagttctatctcgagactaagctgggcgga
ccccaacagcagcagcagggatccccgctttatgagctcaggacgaagctcctccgtacc
ttgactgattgctctcacctccttcaggcgtacaaacccctcgcctcagatccggaccag
aagaagaacctaagacgcatcaggaagaagctcacccactgccagaacccggacaaggct
ggagtagcgggccagaagcgtatccctgctgcggcggcagcagtagcagcggctggtgat
ccggcaacctctgagagcgagatggagcgactggcaaagaagcgcaagttagacggggga
cagccgaatgatatatttggaggtgaattagtgacgcaacggacgaaggaggcgcaacag
cctcaatag

DBGET integrated database retrieval system