KEGG   Aspergillus oryzae: AOR_1_526114Help
Entry
AOR_1_526114      CDS       T01018                                 

Gene name
AO090701000285
Definition
O-methyltransferase
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
aor  Aspergillus oryzae
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    AOR_1_526114 (AO090701000285)
Enzymes [BR:aor01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     AOR_1_526114 (AO090701000285)
Exosome [BR:aor04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   AOR_1_526114 (AO090701000285)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 275 aa AA seqDB search
MSQNQPTTRQRNDEAELDLLDFIYAQPNRDEIQGNPQKVLDLIDEFAKSRHLIHVGPEKG
KVVADLIAERKPQTMIELGGYVGYSAILFGDAVRRAGGKKYYSLELNPEYAAISTLLLDL
AGLRDFVQILVGRSDQSLNKLCASGEVPQVEIMFIDHYKPAYTTDLKLCEQLGMIVPDVS
VLVADNVLYPGNPPYLEYVRSTVEQKRKAAEKGPIQMYNTEGIPAVSVRAFLGSDSTPLF
DILGDPNLVYESTLNQPDGLRDALEITRCVGVEKA
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaaaaccagcctacaactcgtcagcgcaatgacgaagccgaactcgaccttctc
gacttcatctacgcccagccaaaccgggatgagatccaaggaaacccccagaaagtactg
gatctgattgacgaattcgctaaatcgcgtcacctcatccatgtggggcccgagaaaggg
aaggtcgtagcagacctcatagcggagcgcaagccccagaccatgatcgaactcggaggt
tacgtgggttactcggccatcctgttcggcgatgccgtgcgtcgggccggtggcaaaaag
tactacagtttagagttgaaccctgaatatgccgccatctcgactctgttgctggatctg
gcgggcctccgagattttgtccagatcctggtgggtcgcagcgaccagtccctgaataag
ttgtgtgccagcggcgaagtcccacaggtggaaattatgttcattgatcactataagccc
gcgtatactacggatctgaagctatgcgagcagcttggcatgatcgttcccgatgtttcg
gttctggtggctgataacgtgctctatccggggaatccaccgtacctggagtatgtccgg
agcacggtggagcagaaacgaaaggcggctgagaaggggccaatccagatgtataacacg
gagggtatacctgctgtgagtgtgcgggcctttcttggctcggattcgacgcctctgttt
gacatcctcggggacccgaatttggtgtatgagagcaccttgaatcaaccggacggactt
cgggatgcccttgagattactcgatgtgtaggagttgagaaggcgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system