KEGG   Aspergillus oryzae: AOR_1_528184Help
Entry
AOR_1_528184      CDS       T01018                                 

Gene name
AO090009000320
Definition
ubiquitin carboxyl-terminal hydrolase creB
Orthology
K11872  
ubiquitin carboxyl-terminal hydrolase 9/13 [EC:3.4.19.12]
Organism
aor  Aspergillus oryzae
Brite
Enzymes [BR:aor01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     AOR_1_528184 (AO090009000320)
Peptidases [BR:aor01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   AOR_1_528184 (AO090009000320)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 755 aa AA seqDB search
MGSFLRSLRRDVGPPTPSVGATPAKKEPPVPPVTPLEKMLQDMGAIREDGSDKFFGMENY
GNTCYCNSILQCLYYSVPFREAVVNYPTRTPIESLEAALANTLRYQNFAANLEAEALAEK
QKAANAQRPGAPPNQPQKPEDKDSPEYKKKMALQTLPLLETKNNATSYGMSESLFTSLKD
LFESVVASQSRIGIIRPQHFLDVLRREHEMFRTAMHQDAHEFLNLLLNEVVANVEAEASK
QPEPERSLPPAESADSTELSGSSGSKTPNTTRWVHELFEGTLTSETQCLTCEKVSQRDEV
FLDLSVDLEQHSSVTSCLRKFSAEEMLCERNKFHCDNCGGLQEAEKRMKIKRLPRILALH
LKRFKYTEDLQRLQKLFHRVVYPYHLRLFNTTDDAEDPDRLYELYAVVVHIGGGPYHGHY
VAIIKTQDRGWLLFDDEMVEPVDKNYVRNFFGDRPGLACAYVLFYQETTLEAVMKEQEQE
NMDLNTSVADINDSTLKQNGYPLSPGLAHVHSASQIPSPSEPARFSNLQRAPTAPPLFPH
PEHADSESSPADPSTTASATPPVPPIPDIHSLPLSPKKSDSHFKKERAKEEKERKANEKE
KEKQRRRDQEARIREQRREDAEIRAALEASKASKAEEDRRHSPDDTKKSSHGLSRLKRGS
KSFSHRLGKDKENRVSSSSHSATPIAEHPPSRNGASESQQQLPNGQSPGSHGLHTRHTGL
DEERDTLKDPKHDRSGHHGKWRSFSLKKKSFSILS
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atggggtcgtttctaaggagtctacgcagagatgtgggacctcccacaccctcagttggg
gcgactcccgcaaagaaagaaccaccagtgcccccggtgacccctttagaaaagatgctc
caggatatgggtgcgatccgcgaggatggtagtgacaagttttttgggatggagaattac
ggtaatacctgttattgtaattcgatcctacagtgtctatattattccgttccttttcga
gaggctgtcgttaattacccgacccgaactcctatagagagtctggaagcggcgctggca
aatactcttcgctatcaaaacttcgccgccaacttggaagccgaggcgctggccgagaaa
cagaaagctgccaatgcccagcgtcctggcgcgcctccgaatcaaccgcaaaaaccagag
gacaaagactcgcctgaatataagaagaagatggcattacagacgctgcccctcttggag
actaagaacaacgcgaccagctatggaatgtcagagtccctcttcacgtcgttgaaagac
ttattcgagtctgttgtcgcaagccagtcacggataggtataatccgaccacagcacttt
ttggatgttctccgacgcgaacacgaaatgtttcggactgccatgcatcaagatgcccat
gaattcctaaacctacttctcaacgaagttgttgcgaacgtggaggcagaggcatctaaa
caacctgaaccagagagaagtcttcctccagctgaaagcgcagactcgactgagctatcg
ggaagttcaggctctaaaacacccaacactactcgctgggtacatgaattatttgaaggg
actttgacctcggaaacacagtgtttaacttgcgagaaggtttcgcaacgtgacgaagtt
ttcttggacttgtcggtagatcttgaacagcactcgtcggttacgtcgtgtttgaggaag
ttctcagcggaggagatgctttgcgaaagaaacaagttccactgtgataactgcggtggt
cttcaagaggcggaaaagaggatgaaaatcaagcgcctgcctcggattctggccctgcac
ctcaaacgattcaaatataccgaagacctgcaacgacttcaaaagctgttccatagggtt
gtatatccctatcaccttcgccttttcaatacgacagacgatgcggaggacccggatcgt
ttatacgagctgtatgcagtggtggtgcatatcggtggcgggccatatcatggacactat
gtcgccattattaaaacacaagatcgcggatggttgctgtttgacgatgagatggtagag
cctgtggacaagaactatgtccgtaatttctttggtgacaggccaggcctcgcctgcgcc
tacgtcctattctatcaggagaccacacttgaggctgttatgaaagaacaagagcaagaa
aacatggacctaaacacgagcgtcgccgatatcaacgactcaaccttaaaacagaatggc
tatcctctatctccagggttggcccatgttcacagcgcatctcagataccatcacccagt
gaaccagcccgattcagcaatctccaacgggcccctactgcacctcctttattccctcac
ccggaacatgcagactctgaaagttcccccgcagatccttcgactactgcatctgccacc
cctcctgttccaccaataccggacattcattctctccctctcagccccaagaagagcgac
tctcatttcaaaaaggaacgggccaaagaggaaaaggagcgaaaagcaaacgagaaagaa
aaagagaaacagcgccggagggatcaggaagcgagaatcagagaacagcgacgagaggat
gctgaaatccgagctgcgctcgaggcgagcaaggcgtccaaggccgaggaagatcgtcga
cattcccccgatgacaccaagaagtcaagccatggcttgagccgtctgaagcgcggtagc
aagagcttcagccatcggctcggcaaagataaagagaatcgagtttcttcatccagtcac
tcagcaacacctattgcggaacacccaccatcaagaaacggggcctccgaatcacagcaa
caactacctaacggccaatctccaggttctcatggcttacatactagacatacaggactg
gatgaagagcgggatacactcaaagatcccaaacacgacagaagcggacatcatggaaaa
tggaggagtttcagtctcaagaagaagtcatttagcattctttcatga

DBGET integrated database retrieval system