KEGG   Aspergillus oryzae: AOR_1_542184Help
Entry
AOR_1_542184      CDS       T01018                                 

Gene name
AO090009000327
Definition
histone acetyltransferase GCN5
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
aor  Aspergillus oryzae
Brite
Enzymes [BR:aor01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     AOR_1_542184 (AO090009000327)
Transcription machinery [BR:aor03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     AOR_1_542184 (AO090009000327)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 405 aa AA seqDB search
MASENNKRKASEEALSPDSQLQSKKARTDSPEREPKSEGGPLGKPPLRIVPFPEKPAVLE
ERRGEIEFRVVNNDGSRDSFVVLTGLKCIFQKQLPKMPKDYIARLVYDRSHLSIAIVKHP
LEVVGGITYRPFNSRRFAEIVFCAISSDQQVKGYGAHLMSHLKDYVKATSPIMHFLTYAD
NYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTIMQCTMLPKIRYLEIGRMLLKQKEAV
HAKIRAFSRSHIIHAPPKEWKNGACKIDPLSIPAIKQSGWSPDMDELARQPRHGPNYNQL
LHLLNDMQNHSAAWPFTQPVNRDEVPDYYEVIKEPMDLSTMEEKHEKDMYPTPQDFIKDA
MLIFDNCRRYNNENTPYAKSANKLEKFMWQQIRNIPEWSHLADGH
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcagaaaacaacaaacggaaagcttcggaggaagccctttccccagattcacag
ctacagagtaagaaagcgcgcaccgattccccagagagggaaccaaagtctgaaggtgga
ccattgggaaagccaccattgaggattgttcctttcccggagaagccagccgtactagaa
gaacgtcgaggggagatcgaattccgggtcgttaataatgatggttcgcgcgacagcttt
gttgtcctcactggactgaagtgcatctttcagaagcagctcccgaagatgcccaaagat
tacattgctcgattggtctatgatagatcgcatttatctatcgccattgtcaaacatcca
ctggaagtagtaggaggaattacatacaggccttttaacagtcgcagatttgcggagatt
gtcttttgtgccatatcctctgatcaacaggtgaagggttatggtgcgcatttgatgtct
cacctgaaggattatgtgaaggcaacgtcgcctatcatgcatttcctgacatatgcggat
aactatgctattgggtatttcaagaagcaagggttcaccaaggaaattacactggataag
tctatctggatgggttatattaaggattatgaagggggcaccattatgcaatgtacgatg
cttccaaaaatacggtatcttgaaattggccgtatgcttctaaagcagaaagaagcagta
cacgccaagatccgtgccttcagccggtcacatatcatacacgccccgccaaaggaatgg
aaaaatggagcgtgtaaaatcgatccgttaagtatcccggcaatcaagcaatctggatgg
tcacccgacatggatgagttagcgcgtcaaccacgccatggaccgaattacaatcaacta
ctacatctgctgaacgatatgcaaaaccatagtgcagcctggccttttacgcagccggtc
aatcgtgacgaggttcctgattattacgaagtgatcaaggagccaatggatctgtcgacc
atggaggaaaaacatgagaaggacatgtatccaacaccacaagatttcatcaaagatgct
atgttgatcttcgacaattgtcgaagatacaacaacgagaacacgccttatgcaaaaagt
gcgaataaattggagaagtttatgtggcagcaaattcgaaatattcccgagtggtcgcac
ctggcggatggccactga

DBGET integrated database retrieval system