KEGG   Aspergillus oryzae: AOR_1_552154Help
Entry
AOR_1_552154      CDS       T01018                                 

Gene name
AO090003000321
Definition
glucoamylase
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
aor  Aspergillus oryzae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AOR_1_552154 (AO090003000321)
Enzymes [BR:aor01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     AOR_1_552154 (AO090003000321)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 493 aa AA seqDB search
MRNNLLFSLNAIAGAVAHPSFPIHKRQSDLNAFIETQTPIAKQGVLNNIGADGKLVEGAA
AGIVVASPSKSNPDYFYTWTRDAGLTMEEVIEQFIGGDATLESTIQNYVDSQAKQQAVSN
PSGGLSDGSGLAEPKFYVNISQFTDSWGRPQRDGPALRASALIAYGNSLISSDKQSVVKA
NIWPIVQNDLSYVGQYWNQTGFDLWEEVQGSSFFTVAVQHKALVEGDAFAKALGEECQAC
SVAPQILCHLQDFWNGSAVLSNLPTNGRSGLDTNSLLGSIHTFDPAAACDDTTFQPCSSR
ALSNHKLVVDSFRSVYGINNGRGAGKAAAVGRYAEDTYQGGNPWYLTTLVAAELLYDALY
QWDKQGQVNVTETSLPFFKDLSSNVTTGSYAKSSSAYESLTSAVKTYADGFISVVQEYTP
DGGALAEQYSRDQGTPVSASDLTWSYAAFLSAVGRRNGTVPASWGSSTANAVPSQCSGGT
VSGSYTTPTVGSW
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgcggaacaaccttcttttttccctcaatgccattgctggcgctgtcgcgcatccgtcc
ttccctatccataagaggcagtcggatctcaacgccttcattgagacacagacacccatc
gccaaacagggcgtcctcaataatatcggcgctgatggcaagcttgttgagggggctgcc
gctggtatcgttgtagcctccccatccaagagtaatcccgactacttctatacctggacg
cgcgatgctggcctcaccatggaagaagtgatagagcaattcatcgggggagatgcgact
ctcgagtccacaatccagaattatgttgactctcaagcgaagcagcaggcagtctccaac
ccatcaggcggcctgtcggatggctcgggtcttgctgaacccaaattttacgtcaatatc
tctcaattcaccgattcctggggccgaccccagcgcgacgggccagccttacgtgcttcc
gccttgatcgcatatggcaactctctgatttccagcgacaaacaatctgttgtcaaagct
aacatctggccaattgtccagaatgacttgtcttatgtgggtcaatactggaaccagacc
gggtttgatctttgggaagaggttcagggcagctccttcttcactgttgctgtgcagcac
aaagccttggtggagggcgatgcgtttgcaaaggcactcggagaggaatgccaggcatgc
tccgtggcgcctcaaatcctttgccatcttcaggacttctggaatgggtctgctgttctt
tctaacttaccaaccaatgggcgcagtggactggataccaactctcttttgggctccatt
cacacttttgatccagccgccgcttgtgatgatacaacattccagccctgctcctctcgc
gccctgtcgaaccataagcttgtggttgactctttccggtcggtctacggtatcaacaat
ggacgtggagcaggaaaggccgcggcagtgggccgctacgcagaggacacctatcaggga
ggcaatccatggtatcttaccaccctggtcgctgcggaattgctctacgacgccttgtat
cagtgggacaaacaaggtcaagtgaacgtcactgaaacttcccttcccttcttcaaggac
ctctccagcaatgtcaccaccggatcctacgccaagtcttcctcagcctatgagtcgctt
acgagcgctgtcaagacctacgcagacggcttcatctccgttgtccaggagtatactccc
gatggcggtgctttggctgagcagtacagtcgggaccagggcaccccagtttcggcatcc
gatctgacttggtcttatgcagctttcttgagtgctgttggacgacgaaacggcactgtc
cctgctagctggggctcttccacggccaacgcagttccaagccaatgttcggggggtaca
gtttctggaagttacactaccccaactgttgggtcgtggtag

DBGET integrated database retrieval system