KEGG   Aspergillus oryzae: AOR_1_570184Help
Entry
AOR_1_570184      CDS       T01018                                 

Gene name
AO090009000347
Definition
MAP kinase kinase (Mkk2)
Orthology
K08294  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
aor  Aspergillus oryzae
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:aor00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    AOR_1_570184 (AO090009000347)
Enzymes [BR:aor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     AOR_1_570184 (AO090009000347)
Protein kinases [BR:aor01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   AOR_1_570184 (AO090009000347)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 506 aa AA seqDB search
MSTPAVPLLKPPVPGNRNNSNGPRPPKLTLGIPPSPNARPVTGNGIPAPAPVPAPALAPE
VPQLQRPSTRPAPPQLRLATPMGSSKNIQQVNGRPAPPPLATSGLNEPNGHSRSGSFNYL
DGKASGPASASSSNYSALSFAMGLRQPQGSTPDPSSAISSVYSDREGGVQMERDNSVNGL
IPDLDKLSLEKGRPLDVDDLDDEGWLAASEQKKIVELGSLGEGAGGAVTRCKLKEGKTVF
ALKIITTDPNPDVKKQIVRELNFNKDCASEHICRYYGAFMDKSTGTISIAMEFCEGGSLD
SIYKEVKKLGGRTGEKVLGKVAEGVLNGLTYLHSRKIIHRDIKPSNILLCRNGQVKLCDF
GVSGEFGTKGDANTFIGTSYYMAPERITGQSYTITSDVWSLGVTLLEVAQHRFPFPADGT
EMQPRAGLIDLLTYIVRQPIPKLKDEPGNGIRWSDSFKYFIECCLEKEPPRRATPWRMLD
HPWMLDMKNKKVNMANFVRQVWGWDN
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacacccgcggttcccctcctcaaaccgcccgtgccgggtaatcgcaacaacagc
aatggtccccgacctccaaagctcaccttggggatccccccgtctcccaacgctcgtccc
gttaccggtaatggtataccggctcctgcgcccgttccagcccccgctttagcccccgaa
gtgccacagctccagcgcccgtccacccgcccggcgcccccgcaactacgactggcgacc
ccaatgggcagcagtaagaatatccaacaagtcaacggtcgcccagctcccccgcctctt
gctaccagtgggttgaacgaaccgaacggacactcacggtcaggtagcttcaactatttg
gatggaaaggccagtggccccgcatcggcttcatcgtcaaattactcggctttgtcgttc
gccatgggtcttcgtcaaccacagggtagcactccggatccgtcgtcagctattagctcg
gtttactccgatcgggaaggaggtgtgcagatggagcgggacaacagcgtaaacggattg
attccagatctcgacaagttgagtttagaaaagggcaggccactagacgtcgacgatttg
gatgatgaaggctggcttgcggccagtgaacagaagaagatcgtggagttaggcagtttg
ggtgagggagcgggaggtgcggtcactcgttgcaagctcaaggagggaaagaccgtcttc
gcgttgaagattatcacaaccgaccccaacccagatgtaaagaagcagattgttcgggaa
ctcaacttcaacaaggactgtgcctcggaacatatctgtcgatattacggtgcattcatg
gacaagtctaccggcacgatttcgattgcgatggagttctgcgaggggggcagtctagac
agtatttacaaagaagtgaagaagctagggggtcgaacaggagagaaagtgctgggtaag
gtcgcagaaggggtattgaacggtttaacatatctgcacagcagaaagattatccatcga
gacatcaaaccgtctaatattctcttgtgtcgcaacggacaggtcaagctatgtgatttt
ggcgttagtggagagttcggcaccaagggcgatgctaatacgttcattgggacttcctac
tacatggcacccgaacggattactggtcaatcttatacgattacgtcggacgtctggtct
ctaggcgtaacgctccttgaagtcgcccagcatcgcttccctttcccggccgatggaact
gaaatgcagccccgcgctgggttaatcgacctccttacatacatcgtccgtcaaccgatt
cctaaattgaaggatgagccgggtaatggtattcgctggtctgatagcttcaagtacttt
atagaatgctgtctcgagaaagagcctccacgaagagcgactccatggcggatgctggat
catccgtggatgctggacatgaaaaacaaaaaagtcaacatggcgaacttcgtgcgacag
gtgtggggatgggacaactag

DBGET integrated database retrieval system