KEGG   Aspergillus oryzae: AOR_1_578034Help
Entry
AOR_1_578034      CDS       T01018                                 

Gene name
AO090103000353
Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
aor  Aspergillus oryzae
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AOR_1_578034 (AO090103000353)
Enzymes [BR:aor01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     AOR_1_578034 (AO090103000353)
Peptidases [BR:aor01002]
 Cysteine Peptidases
  Family C44
   AOR_1_578034 (AO090103000353)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 668 aa AA seqDB search
MCGIGAFLDFHNHSQPVSHQQLESEIDNGLDFIKHRGPDARGKWVNADGRVGLGHIRLSI
VDPSPSGNQPFHDSRGDIHAVVNGELYDHERYREQLASEFDFKGNSDCEIVIALYKHYGA
SFLSHLRGEFALVLWDAKRELFFAARDRYGIKSLYYTLVNNRLLVATEMKSFLAFGWKPE
WCIRSLRSLSWQHGSNTFFKGVYNIRPGHYLLSQSFGPLEQTEYWDCEFPDKRALEPRSE
EEIILGLRKHLLEAVKLRLRADVPAGVYLSGGLDSTAVAGMVSHLMKNGERLGNNPDGLK
SQLHCFTVQFDRDSGYDESDVAERTATWLGANCHLVPVDEAVLAAGFEDTIWFSESPLPD
LCGVGKLALAEAVHKEGIKVVLTGEGADEHFGGYSYLRLDALAEPDPSWPAAQFPESERL
QMHEKLYRQVDSSGSVGRVESAERMLNGSFYGQEMAYFNFLPFASWTDLYASVPPHTALA
ESFSGSTRDRMMNKWHLLHTSEYISIKTFLSTFILRNAGDNVDMVHQVESRPPFLDHRVT
EYANQIPPSLKMSVDPVSKTFRDKHILREAVKPFIPDEIYSRPKRSYAAPVRYPKDGPLC
QLFNQLVTEENVKKLGFVDWGKAKGNLHRAFEGSDDMAFRFTLTLAQFVVLMQRFGVATC
CPSPNALS
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattggggcatttctggatttccacaatcactctcaaccagtgagccatcaa
cagcttgagtctgaaattgataatgggctcgacttcataaaacacagagggccagatgct
cgaggaaaatgggtcaatgcagacggccgtgtggggctcggccacattcgtctgtctata
gttgatccaagccccagcggaaatcagccttttcatgattctcggggtgacattcatgcg
gtcgtcaacggcgagctgtatgatcatgaacgctatcgggagcaactagcatcagagttt
gacttcaagggaaatagtgactgtgaaattgtcatcgccttgtataagcactatggcgcg
tcctttttatcgcacctgaggggcgagtttgccttggtcctctgggatgcgaagagagag
ttgttctttgctgcacgcgatcggtatggtatcaagtcactttattacaccctcgtcaac
aatcgccttttagtcgcaactgagatgaaatcgttcttggcctttggatggaagcctgaa
tggtgtattcggagtttacggtcgctttcgtggcaacatggatcaaacacctttttcaaa
ggcgtatataatattcgaccgggtcactacctcctcagtcagagcttcggtccattggag
caaaccgaatactgggactgtgagttccccgacaagagagccttggaaccgcgttcggaa
gaggaaataattctgggacttcggaagcatcttctggaggctgtgaagctccgtctacgg
gctgatgtgccggccggtgtttacctgagtggcgggttagactccaccgccgtggctggg
atggtctcccacttgatgaagaacggagaacgccttgggaataaccccgatgggttgaag
tcgcagctgcattgctttacagtgcagtttgaccgggatagtgggtatgatgagtctgat
gtcgccgaacgtaccgctacttggcttggcgccaattgtcatctcgtgcccgtcgatgaa
gctgtccttgccgcagggtttgaggataccatttggttcagcgaatcaccactgccggat
ctatgtggcgtggggaaactggcgctggcggaggcagtacataaagaaggcatcaaggtc
gtgcttacaggtgagggtgccgatgagcatttcggaggttactcgtacttgagactggat
gccctggctgagccagatccgtcctggccagccgcgcaattccctgagtcagaaaggctt
caaatgcatgagaagctttatcgccaagttgactcctctggttctgtcggacgggtcgag
tcggccgagcgcatgctcaacggctcattctatggtcaagaaatggcgtatttcaacttt
ctacccttcgcatcctggacagatctctacgcctctgtccctccacacactgcccttgct
gaaagtttcagcggtagtactcgcgaccggatgatgaataaatggcatctcctgcacaca
tcagagtatatttcgatcaagaccttcctgtcaacctttatccttcgcaacgcgggcgat
aacgtggacatggttcaccaggtggagagtagacctccatttctggatcatcgcgttacc
gagtatgccaaccagattcctcccagtttaaagatgtctgtcgacccagtctcgaagacg
tttcgcgacaaacacattcttcgtgaagcagtgaagcctttcattcccgatgagatatac
tctagacccaaaaggtcctacgccgcaccagtccgctatccaaaggatggaccactatgt
cagctcttcaaccaattagtgactgaggagaatgtcaagaagcttgggtttgtggattgg
ggaaaagccaaaggcaacctacacagagcatttgaaggttctgatgacatggcgtttaga
tttacccttaccctcgctcaatttgtggttctgatgcagagatttggagtagcgacttgc
tgcccgagcccaaatgctctttcctaa

DBGET integrated database retrieval system