KEGG   Aspergillus oryzae: AOR_1_580054Help
Entry
AOR_1_580054      CDS       T01018                                 

Gene name
AO090011000341
Definition
protein kinase Yak1
Orthology
K18670  
dual specificity protein kinase YAK1 [EC:2.7.12.1]
Organism
aor  Aspergillus oryzae
Brite
Enzymes [BR:aor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     AOR_1_580054 (AO090011000341)
Protein kinases [BR:aor01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   AOR_1_580054 (AO090011000341)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 897 aa AA seqDB search
MDSQWQPYQDPLMGRPAQLNNGLTSNPPQLGPKYGGQPQQSQPPVGYTYEAFQTPGIAAK
PASTGMNSKSVSMASSPAATPRSRDYVTDADTTMEDADPYNRAKYSARPSHHSRPSSQYF
PTEESSAARRYSPMNVLSPSMPYNTSPGKPHNAYAFPPGPNQTRRSPTRVPNYSSPPQPF
QSPPSGSRAPRLPPLQPTDMSPEQFYPPSAGSQLSAPFGQDGRSPRSASISGGSQQPGRG
PVPKFQKIKSVQELKPRVNAQPPFRRANPEGGFISPLQALTTHLPATYRICNPGFNYESS
RNPRRVLTKPSKGVKNDGYDNEDSDYILYVNDILGSEEAGHKNRYLILDVLGQGTFGQVV
KCQNLKTQEVVAVKVIKNKTAYFNQSMMEVSVLDLLNSRYDKNDDHHLLRLKDTFIHRQH
LCLVFEILSVNLYELIKQNQFRGLSTTLVRVFAQQLLNALSLLNKAHLIHCDLKPENILL
KNLESPIIKVIDFGSACDERQTVYTYIQSRFYRSPEVLLGLPYSSAIDMWSLGCIVVELF
LGLPLFPGSSEYNQVCRIVEMLGLPPTWMLEMGKQSGEFFEKTQDEFGRKTYRLKGLEQY
SREHGTKEQPSKKYFQASTLEEIIRSYPMPRKNMKQAEIERELNNRVAFIDFVRGLLSIN
PLERWSPQQAKLHPFITQQKFTGPFVPPMNLKYSSLNKTVAPGIQQQQQAEAASKQRAAQ
AAHAQSAAQTAYSMQLNQFHTPTHAQPPPPMYNGVFTGHQQGAPPPYPTQQPPGYGHQMN
LMPGQMPQSQYAPSQSLYAQATTRAGRQRASTMDPQGGGIPPTIQRVASHLDPNAPIRLQ
PSPAYYPPPPDGYVDAGAANQRRRGSRAGGTRNRDFIRTLEDGVLGGDGFMGQNQWH
NT seq 2694 nt NT seq  +upstreamnt  +downstreamnt
atggattcgcagtggcagccataccaggatcccttaatgggtcgtcctgcgcagttgaat
aatgggttgacgtctaatccaccgcagctcggtcccaaatacggcggtcaaccacagcag
tcccaaccgcctgtgggatacacctacgaagcctttcaaacccccggaatcgcagcaaaa
cccgcgtcgaccggtatgaactcaaaatccgtatcgatggcgtcgtctccagctgcgacg
ccacgtagccgcgattatgtcaccgatgcagacacgacaatggaagatgcggatccgtat
aaccgggcaaaatattcagcgaggccatcccaccatagccggccttcctcccagtacttt
cccactgaggaatcatcggccgcccgtaggtattctccgatgaacgtgctgtcaccatcg
atgccctacaatacgagtcccggaaagcctcacaacgcgtatgcctttcctcctgggcca
aatcaaactcgccgttcaccaacaagggtgccgaattactcctcgccgcctcagccgttt
cagtcgcctccatctggttcacgcgccccgcggcttccccctttgcagcccacagacatg
agcccagagcaattctaccccccgtcggcaggatctcaactcagtgcaccttttgggcaa
gatggaagatctcctcgctctgcgtcgatatccggcggcagccaacaaccaggtcgaggc
ccagtaccaaagttccagaagatcaaatcggttcaggagctgaagccgcgcgttaatgcg
caacccccatttagacgtgctaaccctgagggtggcttcattagtccgctccaagccctg
accacgcacctccctgctacatatcggatatgcaaccctggctttaactacgaatcctcg
agaaacccaaggcgagttttgacgaagccgagcaagggagtcaagaatgatggttacgac
aatgaggacagtgactatattctgtacgtcaacgacattttggggagcgaggaagcaggc
cacaagaatcgctacctcatcctcgatgtactaggacagggaacttttggccaagttgtg
aagtgccagaatctaaaaacacaggaagtcgtggctgtcaaagtaatcaagaacaagacc
gcatactttaaccaaagcatgatggaggtgtctgtcttggatctgctcaacagcagatat
gataagaatgatgaccaccatctattacgacttaaggacacgttcattcaccgacagcat
ctctgtttggtatttgagatactaagtgttaatctttacgagttaatcaaacagaaccaa
ttccgagggttgagtacgacactagtgcgtgtatttgctcaacagctcttgaacgcgttg
agcctgttgaacaaggcgcacttgattcactgcgacttgaagccagagaatatattatta
aaaaatcttgagagtcccataattaaggtcatcgattttgggtctgcttgtgatgaacga
cagacagtgtacacatatatacagtcaaggttttaccgctctccggaggttctccttgga
ttaccttattcgtcggcgatcgacatgtggtcactaggatgtatcgtcgttgaactcttc
cttggtttgcctctctttccaggatcttcagaatacaatcaggtttgccggattgtggaa
atgctaggtctgccgccaacgtggatgttagagatggggaagcagtctggtgaattcttc
gaaaagacccaggatgagtttggaagaaagacatatcgcctgaaaggcctggagcaatat
tcgcgggagcatggcacgaaggagcagccgagcaaaaaatactttcaggcgtcgacatta
gaagaaattattcgaagctacccgatgccgagaaaaaacatgaaacaagcagaaattgag
cgagagctaaacaaccgagtggcttttattgattttgttcgtggcttgttatcaatcaat
ccgctggagcgctggtctccacaacaagccaagctgcatcctttcattacgcagcagaag
tttacagggccttttgtacctcccatgaacctaaaatactcttctcttaataagactgtt
gctcctggtattcagcagcagcagcaggccgaggccgcaagcaaacaaagagcggcgcaa
gcagcacatgctcagtcagctgcacagactgcctactcgatgcaactgaaccagttccac
acacccacccatgcccagcccccacctcccatgtacaacggggtgttcactggccaccaa
caaggcgcccctccgccgtaccctacccagcagccacctggctacggtcatcaaatgaat
ctaatgccaggtcagatgcctcaatcacagtatgcaccgtcccagagtctctatgcccag
gcaactacaagagcgggtcggcaacgtgcctccacgatggaccctcagggtggcgggatc
ccaccaactattcagcgagttgctagtcatctcgacccgaacgcacccattcgattacaa
cccagcccggcatattaccctccccctcctgacggatacgttgacgccggtgctgcgaat
caaagacgacgagggagtcgcgcaggtggcacacgtaaccgggacttcattaggacactt
gaagacggcgtattagggggagatggtttcatgggccagaaccagtggcactaa

DBGET integrated database retrieval system