KEGG   Aspergillus oryzae: AOR_1_580134Help
Entry
AOR_1_580134      CDS       T01018                                 

Gene name
AO090102000339
Definition
acyl-CoA desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
aor  Aspergillus oryzae
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    AOR_1_580134 (AO090102000339)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    AOR_1_580134 (AO090102000339)
Enzymes [BR:aor01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     AOR_1_580134 (AO090102000339)
Lipid biosynthesis proteins [BR:aor01004]
 Desaturase
  First
   AOR_1_580134 (AO090102000339)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 469 aa AA seqDB search
MALDAKSPTVATLNDGTTDYVPMRKKYTSNQPHITEQPITWGNWYKHVNWLNCFFILFIP
FLGCLGAYWTPLHLYTGIFAVVYYFNAGLGITAGYHRCWAHRCYKATLPLRIYLAAAGAG
AGQGSIRWWSRGHRSHHRYTDTEKDPYSVQKGFWYSHIGWMVLKQNPKRIGRTDVTDLDA
DPVVVWQHTNYIKSALFMCLVFPTLVCGLGWGDWLGGFVYAGILRVFFIQQATFCVNSLA
HWIGEQPFDDRNSPRDHVITAFVTLGEGYHNFHHEFPSDYRNAIEWWQYDPTKWSIWIWK
QLGLAYDLKQFRQNEIEKGRIQQLQKKLDQKRSTLDWGIPLDQLPVMDWDEFVAEAKNGR
ALVTIGGVIHDITSFIKEHPGGKAFISSAVGKDATAIFNGGVYNHSNAAHNLLSTMRVAV
LRGGCEVEIWKRSLPEGKMPMLMDSTGRRIVRAGDQVTRMVQPVPMVSA
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcgatgcaaaatcaccgacagttgctactttaaacgatggcactacagactat
gtccccatgaggaaaaagtacacctccaaccagccgcacatcactgagcaacccatcact
tggggcaactggtacaagcatgtcaactggttgaactgtttctttattctcttcattccc
ttcctaggctgccttggagcatactggacacctctccatctctatacgggcatcttcgcc
gtggtatactacttcaacgcaggtcttggcatcacggccggataccaccgctgctgggcc
cacagatgctacaaagcaactctcccattgaggatctacctagccgccgcaggagccggt
gcaggacaaggctcgatccgatggtggtcccgcggccaccgttcccatcaccgatacacg
gatacagagaaggacccatactccgtccaaaaaggattctggtattcgcatattggctgg
atggttctgaagcagaacccgaaacgaatcggtcgcacggacgtcactgatcttgacgcc
gatcccgtcgtcgtctggcagcataccaactatatcaagtcagctctgttcatgtgtctc
gtctttccgacgttggtctgcggcctaggctggggtgattggcttggtggattcgtgtac
gctggaatcctccgcgttttcttcattcaacaagccaccttttgtgtgaattcccttgcc
cattggatcggcgaacaacccttcgatgatcgcaattccccaagagaccacgtcataacc
gccttcgtaaccctcggcgagggttaccataacttccaccacgagtttccatccgactac
cgcaacgcgatcgaatggtggcaatacgatccaacaaaatggtccatctggatctggaag
cagctcggtctcgcctacgatctcaagcaattccgccagaatgagatcgaaaaaggtcgc
atccagcaattgcaaaagaagctcgatcaaaagcgctctactctcgactggggtattccc
cttgatcaactccccgtaatggactgggacgagttcgtggccgaagccaagaacggcagg
gcccttgttactatcgggggcgttattcatgatattacgagttttatcaaggagcatcct
ggtggcaaggcgtttatttcgtcggccgttggtaaagacgctacggctatctttaatggt
ggggtctataaccattctaatgcggctcataatttgctttcgactatgcgggttgcggtt
ctgcggggtgggtgtgaggtggagatttggaagcgttctctgccggaagggaagatgccg
atgctgatggattcgactggtcggcggatcgtgagagctggggatcaggttactagaatg
gtgcaaccggttcctatggttagtgcttga

DBGET integrated database retrieval system