KEGG   Aspergillus oryzae: AOR_1_592084Help
Entry
AOR_1_592084      CDS       T01018                                 

Gene name
AO090020000337
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
aor  Aspergillus oryzae
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AOR_1_592084 (AO090020000337)
   00670 One carbon pool by folate
    AOR_1_592084 (AO090020000337)
Enzymes [BR:aor01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     AOR_1_592084 (AO090020000337)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 282 aa AA seqDB search
MSKQPLKLLMLHGYTQSGPLFHAKSRALIKHLTKAFPLHDVTATYPTGPLRLNPADIPGY
EPTQETPTEPLEAYGWFRRSNTASPPEYLGLEDGLAAVAKVMSEEGPFDGVIGFSQGAAM
AAMVVSLLEPGRKEAFARFLDANVASEGKGETDAVVAGVPFPKAFEGLSHPPFKFALCYS
GFRSPGARYRGFYESPALQTPILHVLGSLDAVVEESRSRALVEACAGDPEKEGKVVWHPG
GHFLPSQRPYLDAAVRFIREQLEGGNKKDAEEEDVNDMDLPF
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaacaacccctcaaactcctaatgctacacggctacacccaatccggccccctc
ttccacgccaaaagccgcgccctaatcaaacacctcacgaaagccttccccctccacgac
gtaacagcaacctacccaaccggccccctacgcctcaaccccgccgacatccccggctac
gaacccacccaagaaacccccactgagcccctcgaagcctacggctggttccggcgctcc
aacaccgcctcgccgcccgaatacctcggtctcgaggacgggctggcggccgtcgcaaaa
gtgatgtccgaggaggggcccttcgacggcgtgatcgggttctcgcagggcgcggccatg
gccgccatggtggtttcgttgctcgagccgggtcggaaggaggcgtttgcgaggtttttg
gatgcgaatgttgcgtcggaggggaagggtgagaccgatgctgttgtggctggggtaccg
tttccgaaggcgtttgaggggttgagtcatccgccttttaagtttgcgctgtgttatagt
ggatttcgctcgccgggggcgcggtatcgagggttttatgagagtccggcgttgcagacg
ccgattttgcatgttttggggtcattagatgctgttgttgaggagtcgaggagtagggcg
ttggttgaggcttgtgcgggagatccggagaaggagggtaaggttgtgtggcatcctggt
ggacatttcttgccgagccagaggccgtacctggatgctgcggtgaggtttattagggag
cagttggagggcggtaacaagaaggatgcggaagaggaggatgtgaatgatatggacttg
cccttttag

DBGET integrated database retrieval system