KEGG   Aspergillus oryzae: AOR_1_6084Help
Entry
AOR_1_6084        CDS       T01018                                 

Gene name
AO090020000006
Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
aor  Aspergillus oryzae
Brite
Exosome [BR:aor04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AOR_1_6084 (AO090020000006)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 141 aa AA seqDB search
MAPKAAEKKPSTGGKAPAGGKAPAEKKEAGKKTAAAASGDKKKRGKTRKETYSSYIYKVL
KQVHPDTGISTRAMSILNSFVNDIFERVATEASKLAAYNKKSTISSREIQTSVRLILPGE
LAKHAVSEGTKAVTKYSSSAK
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggcacccaaggctgctgagaagaagcccagcactggcggcaaggcccctgctggcggc
aaggcccctgctgagaagaaggaagctggcaagaagaccgcggctgctgcctctggtgac
aagaagaagcgtggaaagaccaggaaggagacttactcttcttacatctacaaggtcctg
aagcaggtccaccccgatactggaatctccactcgtgccatgtctattctgaactccttt
gtcaatgacatcttcgagcgtgtcgcaaccgaggcctccaaactggccgcttataacaag
aagtccactatctcgtcaagggagattcagacctctgtcagacttatcctgccaggtgaa
ttggcgaagcatgctgtgtcggaaggcaccaaggctgttacgaagtactcctcttctgcc
aaataa

DBGET integrated database retrieval system