KEGG   Aspergillus oryzae: AOR_1_624134Help
Entry
AOR_1_624134      CDS       T01018                                 

Gene name
AO090102000361
Definition
glycogen [starch] synthase
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
aor  Aspergillus oryzae
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AOR_1_624134 (AO090102000361)
Enzymes [BR:aor01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     AOR_1_624134 (AO090102000361)
Glycosyltransferases [BR:aor01003]
 Polysaccharide
  Storage polysaccharide
   AOR_1_624134 (AO090102000361)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 714 aa AA seqDB search
MASEETGAEPPKRDVRNHMLFEVATEVANRVGGIYSVLKSKAPVTTAEYGERYTLIGPLN
RASAAVEVEELTPSNPRMIETIKSMQERGIEVIYGRWLIEGAPRVLLIDTSTGYKFLDEW
KGDLWNTAGIPSPAADTETNEAIVFGYLVAWFLGEFIAHERRVAVVAHFHEWLAGVALPL
TKKRHMDLTTIFTTHATLLGRYLCAGSVDFYNHLQHFDVDAEAGKRGIYHRYCIERAAAH
TADVFTTVSHITAFESEHLLKRKPDGVLPNGLNVKKFSAVHEFQNLHSQSKEKINDFVRG
HFYGHNDFDLDNTLYLFTAGRYEFRNKGVDMFIESLARLNHRLKASGSKTTVVAFIIMPA
QTTSLTVEALKGQAVVKSLRDTIEMIEKGIGKRMYERCLAWKEGDNMPDEKDLMASQDRV
LLRRRLFAMKRHSLPPIVTHNMNNDHEDPILNQIRRVQLFNDPTDRVKIIFHPEFLNSSN
PVLPLDYDDFVRGTHLGVFPSYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEELIENSS
DYGIYIVDRRMKGVDDSVNQLTDFMFNFALKSRRQRINQRNRTERLSDLLDWKRMGLEYV
KARQLALRRAYPSSFGSGEDFYDIIGGTEQKISRPLSVPGSPRDRSGMMTPGDFASLQEV
KEGLSTEDYIAWRLPGATDEDEPDDQYFPLTLRTKKTSDRPASPLDRISVNGGN
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggccagtgaggagactggcgccgaacctcccaagcgggatgttcgcaaccatatgctt
ttcgaagttgcgaccgaggtggctaatagggtgggtggaatttactccgtcctcaagtct
aaagctcccgtgacgaccgccgaatatggcgagcgatacactctgattggacccttgaac
cgtgcttcagcagcggtggaggtggaagaattgactccatctaatcctcgaatgatcgag
acgatcaagtcgatgcaagaacgtggcattgaggtcatctacggtcgctggctgattgaa
ggcgctccccgggtgcttttgatcgacacatcaacgggatataaattcctggacgagtgg
aaaggggacctgtggaacacggcggggatcccatcaccggctgcagacaccgaaaccaat
gaagcgattgtctttggatacctggtagcatggttcctgggtgaattcatcgcccatgaa
agacgggttgcggtggtcgcccatttccacgagtggcttgctggggtagccctcccgctg
accaagaagcgacatatggatctcaccacaatttttaccacccacgcaactttactcggt
cgctatctctgtgcgggatcagtggacttttataaccacctacagcacttcgatgtggat
gcagaggctggtaagcgtggcatctatcaccggtactgtattgagcgagccgcggcgcac
acggcagacgtcttcactaccgtctcccatatcaccgcgttcgaaagcgagcatctcctg
aaacgaaagccagatggagttctgccgaatgggctcaatgtcaagaagttctccgcagtg
catgagttccagaatctacactcacaatccaaagagaaaattaatgacttcgttcggggc
catttctatggccataacgatttcgatctggacaataccctgtaccttttcacggcggga
cgctatgaattccggaacaagggcgtcgatatgttcatcgaaagcttggctcgcctgaac
catcgcttaaaagccagcggctccaaaactaccgtagttgctttcatcatcatgccagcc
cagaccacgtctctcacggtcgaagccctcaagggacaggctgtcgtcaagtccttacgg
gacacaatcgagatgatcgaaaagggcattggaaagcgaatgtacgagcgttgccttgcg
tggaaggaaggcgacaacatgccggatgagaaggacctcatggccagtcaagatcgcgtg
ctgttgcgacgcaggttgtttgccatgaagaggcactctttaccgccgatcgtcactcat
aacatgaacaatgaccacgaagacccaattttgaaccagatccgccgtgttcagctgttc
aacgatccaaccgaccgcgttaagataatctttcacccagagttcctcaactcgtcgaac
cccgtgctaccactcgattacgatgactttgtccgcggtacgcatcttggagtcttccca
tcatactacgagccttggggttacacacccgctgagtgcactgtgatgggtgtccccagt
atcaccaccaatctgtccggtttcggttgctatatggaggagttaatcgagaactcatcc
gactacggtatttatatagtggatcgccgaatgaagggtgttgacgattccgtcaaccag
cttactgatttcatgttcaactttgctctgaagagccgccgccaacggatcaatcaacgt
aaccgcactgagcggttgagcgatctgttggactggaaacgtatgggattagagtatgtc
aaagcgcggcagctggctcttcggcgagcctacccgtcttcctttggtagcggcgaagac
ttctatgatattattggaggaacagaacagaagatttcacgaccgttatctgtcccaggg
tcaccaagggatcgctcggggatgatgacccctggtgattttgcatccctgcaagaagtc
aaagaaggactgagtactgaggactatatcgcatggcggctgcctggtgcaaccgatgag
gatgaaccagacgaccaatacttcccactgacactacgaacgaaaaagacatccgatcga
cccgcatcgccgctcgaccgcatatcagtcaatggtgggaactga

DBGET integrated database retrieval system