KEGG   Aspergillus oryzae: AOR_1_652184Help
Entry
AOR_1_652184      CDS       T01018                                 

Gene name
AO090009000397
Definition
protein DFG10
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
aor  Aspergillus oryzae
Brite
Enzymes [BR:aor01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     AOR_1_652184 (AO090009000397)
    1.3.1.94  polyprenol reductase
     AOR_1_652184 (AO090009000397)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 322 aa AA seqDB search
MDFLPSLVDWALATAHMDAVDVLRAFFLFASCTILSVSLLDSLRSRFVPYGARATVTAES
DTTPSEPSSSSPLTHILDYLASLKVPHSYFTQFYVVSLLSSVFWALQLMCHGQAFQAIAT
RVHSEHLQRTMSINQIMLCWVLMLAQGVRRLHECFTFSKPSSSQMWFVHWLAGIAFYLAV
SIALWIEGTETLLSHKLSLDDVTVNNAPSLRTFLCLPIFLFASGLQHDAHHYLFSLKKYT
LPSHPLFRSIVCPHYTAECAIYLSLALLAAPRGEMINKTVLSAAVFVTVNLGVTASETKR
WYMQKFGESSVRERWNMIPWVY
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggactttcttcccagtctcgtcgactgggcactggcgactgcccacatggacgcggtg
gatgtccttcgagctttctttctctttgcatcgtgtacgatcctgtcggtcagcctgttg
gattcccttcgttcgcgcttcgtcccttatggcgctcgtgcaaccgtgacggccgagtcg
gatactaccccgtctgagccttcgagcagctcccccttaactcacattctcgactatctt
gcctctttgaaagttccacacagctatttcacacagttctacgtcgtctccctgctatcc
tcggttttctgggcccttcagcttatgtgccatggacaagcgttccaagccatcgcgacg
agggttcactcggaacacctacagaggacgatgtcgatcaaccagattatgttgtgctgg
gtactgatgctcgcgcaaggtgtaagacggttacatgagtgcttcaccttttccaagcct
tcttcttcccagatgtggtttgtccactggctagcaggcattgctttctatctagcagtc
tcaatcgccctgtggattgaggggacagaaacgctgttgtcccataaattgagcctcgac
gatgtaaccgtgaacaacgccccaagccttcgtacatttctctgcttgccaatctttctg
tttgcatctggcctacaacatgacgcccaccactatcttttctctctcaagaagtacacc
cttccctcccaccccttgttccgcagcatcgtatgtccgcactacacggctgaatgtgcg
atctacctatcattggccctgcttgccgctccccggggagagatgatcaataagacagtt
ttgtccgctgccgtctttgtcacggtcaatttaggcgtcactgcgtccgagaccaaacgc
tggtacatgcagaaattcggcgagagctcggtgcgggagaggtggaatatgatcccttgg
gtatactaa

DBGET integrated database retrieval system