KEGG   Aspergillus oryzae: AOR_1_668154Help
Entry
AOR_1_668154      CDS       T01018                                 

Gene name
AO090003000389
Definition
ubiquitin carboxyl-terminal hydrolase
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
aor  Aspergillus oryzae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 490 aa AA seqDB search
MASVACVSLLSEAEFGCEHLTAQLSQDGGAGDQFKASFIKTHNALAPRSRSGESATTQKG
LRTTSFLKPKYMCLTCSESFMNGDRKAHTGKTGHQFYMESRSRTLFCQGCGDFVYDYGLE
RLRSSTPESTLKLAQKRRFSESSTDELYVRSNANKRSCAKQGVRGLFNLGQTCYLNVILQ
TLLHDPILNTYFLGSGHQSHDCTMSDCIACAVAEAFADFNSSDKAEGFAALSLLLASWRA
SSALAGYQQQDAHEYYQFLVDKLHSSTDGHHENHEKGCPCFFHKTFYGKLRSSVTCDKCG
NVTRTDDPMVDLSLDVQVQAKKRAMGGAGPSSTPTLSGCLESFTSPEKLMAGVYNCSGCG
GSAQKATKQLRIKKLPAILCMQLKRYEHTFSVSEKLEGRIDFPLSINMLPYTTNPNSHVD
KSRYIYDLSSAVVHKGKLDAGHYYAYCRQGDEWILFNDDQVTSVTEADVLSADAYLLFYN
LRSLAGAPSQ
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggctagtgtggcttgtgtgtcgctcctctccgaggctgagtttggttgcgagcatctt
acggcgcagctttcccaggacggaggcgcgggtgaccagtttaaggcatctttcatcaag
acacataatgctttggctcctcgctccagatccggggaatcggctactacacaaaaaggc
ctacgtacaactagctttttaaaaccaaagtacatgtgcttgacctgctccgagtcattc
atgaatggcgaccgaaaggcccatacaggaaagaccggtcatcaattctacatggaatcg
agaagccgcacgctattctgtcaaggatgcggagacttcgtttatgattacggtctggag
agactgagatcatcaacaccagaaagcacgctaaaacttgctcaaaaacgtcgattcagc
gaaagctcgaccgacgagctatatgtcaggagcaatgcaaacaagcgctcttgtgcaaag
caaggtgtcagggggctattcaaccttggacaaacatgttatttgaatgttattctccag
acactgcttcatgacccaattctcaacacttactttctaggaagtgggcatcaatcccat
gactgcactatgtctgattgtatagcgtgcgctgttgcagaagcatttgcagacttcaat
agcagtgacaaggcagaagggtttgcggccctgagcctccttttggcctcgtggcgtgca
agttctgccttggcgggatatcagcaacaagatgctcatgaatattaccagttccttgtc
gacaaactccactctagcactgatggacaccacgagaaccacgagaaaggctgcccttgc
tttttccacaagacattttacggcaagctgcgaagtagtgtaacatgtgacaagtgtgga
aatgtcactcgtacggacgaccccatggtggatctaagtttggatgtccaggtgcaggcg
aagaagcgcgccatgggtggtgctgggccctcgtccacgcccacgctgagcggatgtttg
gaaagcttcacttcccctgaaaaacttatggcaggcgtctacaactgcagcggttgcggg
ggaagcgcacaaaaggccacgaagcagctacgcattaagaaattaccggcaattctatgt
atgcaactaaagcgatatgaacatacgttctcggtttccgagaagctagaaggccgcata
gacttcccgctgtctatcaacatgctcccgtacacgaccaaccctaactcccacgttgat
aaatcgaggtatatctacgacctttcatctgccgtggttcataaaggaaagctggacgca
gggcattactatgcttactgccggcagggtgatgagtggatactcttcaacgatgaccaa
gtcacatctgtgacggaggccgatgtcctcagtgccgatgcatatcttctcttctacaac
cttcggtccttggctggtgctccgtcgcagtag

DBGET integrated database retrieval system