KEGG   Aspergillus oryzae: AOR_1_668154Help
Entry
AOR_1_668154      CDS       T01018                                 

Gene name
AO090003000389
Definition
ubiquitin carboxyl-terminal hydrolase
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
aor  Aspergillus oryzae
Brite
Enzymes [BR:aor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     AOR_1_668154 (AO090003000389)
Peptidases [BR:aor01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   AOR_1_668154 (AO090003000389)
Transcription machinery [BR:aor03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     AOR_1_668154 (AO090003000389)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 490 aa AA seqDB search
MASVACVSLLSEAEFGCEHLTAQLSQDGGAGDQFKASFIKTHNALAPRSRSGESATTQKG
LRTTSFLKPKYMCLTCSESFMNGDRKAHTGKTGHQFYMESRSRTLFCQGCGDFVYDYGLE
RLRSSTPESTLKLAQKRRFSESSTDELYVRSNANKRSCAKQGVRGLFNLGQTCYLNVILQ
TLLHDPILNTYFLGSGHQSHDCTMSDCIACAVAEAFADFNSSDKAEGFAALSLLLASWRA
SSALAGYQQQDAHEYYQFLVDKLHSSTDGHHENHEKGCPCFFHKTFYGKLRSSVTCDKCG
NVTRTDDPMVDLSLDVQVQAKKRAMGGAGPSSTPTLSGCLESFTSPEKLMAGVYNCSGCG
GSAQKATKQLRIKKLPAILCMQLKRYEHTFSVSEKLEGRIDFPLSINMLPYTTNPNSHVD
KSRYIYDLSSAVVHKGKLDAGHYYAYCRQGDEWILFNDDQVTSVTEADVLSADAYLLFYN
LRSLAGAPSQ
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggctagtgtggcttgtgtgtcgctcctctccgaggctgagtttggttgcgagcatctt
acggcgcagctttcccaggacggaggcgcgggtgaccagtttaaggcatctttcatcaag
acacataatgctttggctcctcgctccagatccggggaatcggctactacacaaaaaggc
ctacgtacaactagctttttaaaaccaaagtacatgtgcttgacctgctccgagtcattc
atgaatggcgaccgaaaggcccatacaggaaagaccggtcatcaattctacatggaatcg
agaagccgcacgctattctgtcaaggatgcggagacttcgtttatgattacggtctggag
agactgagatcatcaacaccagaaagcacgctaaaacttgctcaaaaacgtcgattcagc
gaaagctcgaccgacgagctatatgtcaggagcaatgcaaacaagcgctcttgtgcaaag
caaggtgtcagggggctattcaaccttggacaaacatgttatttgaatgttattctccag
acactgcttcatgacccaattctcaacacttactttctaggaagtgggcatcaatcccat
gactgcactatgtctgattgtatagcgtgcgctgttgcagaagcatttgcagacttcaat
agcagtgacaaggcagaagggtttgcggccctgagcctccttttggcctcgtggcgtgca
agttctgccttggcgggatatcagcaacaagatgctcatgaatattaccagttccttgtc
gacaaactccactctagcactgatggacaccacgagaaccacgagaaaggctgcccttgc
tttttccacaagacattttacggcaagctgcgaagtagtgtaacatgtgacaagtgtgga
aatgtcactcgtacggacgaccccatggtggatctaagtttggatgtccaggtgcaggcg
aagaagcgcgccatgggtggtgctgggccctcgtccacgcccacgctgagcggatgtttg
gaaagcttcacttcccctgaaaaacttatggcaggcgtctacaactgcagcggttgcggg
ggaagcgcacaaaaggccacgaagcagctacgcattaagaaattaccggcaattctatgt
atgcaactaaagcgatatgaacatacgttctcggtttccgagaagctagaaggccgcata
gacttcccgctgtctatcaacatgctcccgtacacgaccaaccctaactcccacgttgat
aaatcgaggtatatctacgacctttcatctgccgtggttcataaaggaaagctggacgca
gggcattactatgcttactgccggcagggtgatgagtggatactcttcaacgatgaccaa
gtcacatctgtgacggaggccgatgtcctcagtgccgatgcatatcttctcttctacaac
cttcggtccttggctggtgctccgtcgcagtag

DBGET integrated database retrieval system