KEGG   Aspergillus oryzae: AOR_1_690154Help
Entry
AOR_1_690154      CDS       T01018                                 

Gene name
AO090003000401
Definition
uroporphyrinogen-III synthase (UroS)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
aor  Aspergillus oryzae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AOR_1_690154 (AO090003000401)
Enzymes [BR:aor01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     AOR_1_690154 (AO090003000401)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 309 aa AA seqDB search
MPPQFTFNTSSTPILLLKTKSSPTDSYEEYFSAHSYNPTFIPVLEHNFHTPNLTTVKQLF
QSGALNPGPGRKYGGLIFTSQRAVEGFATILNDIGESTKQTSSQSLILYTVGPATSRSLT
SIRDDHLPHATILGSETGNGENLAHFILSHYNPLYDSQDGPKPPLLFLVGEQRRDIIPKT
LMAGSLPPEQRIGVDELVVYETGVMEGFEKSFGEAVRASEEFLGGGVERAVWVVVFSPTG
CDAMVRVLKGLGDGERRVFVATIGPTTRDHLKNKYGFEADVCAEKPSQEGVGMGIVEFME
NRRKNRAGQ
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgccacctcaattcaccttcaacacctcctcgacccccatcctcctcctcaaaaccaaa
tcctccccgacagacagctacgaagaatacttctccgcacacagctacaaccccaccttc
atcccagtcctcgaacacaacttccacaccccgaacctaaccaccgtaaaacagctcttc
cagtcaggagccctgaaccccggcccgggccgcaaatacggcggcctgatattcacaagc
cagcgggccgtagagggattcgcgacgatcctcaacgatattggtgaatcaactaaacaa
acctcctcccaatccctaatcctctacaccgtcggccccgctacatcccgatccctaacc
tccattcgagacgaccacctcccccatgcaacaatcctcggctcggagactggaaacggc
gagaatctagcgcatttcatcctctctcattataacccgttgtatgactcgcaagatggc
ccgaagccgcctctcttgttccttgttggggagcagcggagggatatcatccccaagacg
ttgatggcggggtcgctgccgccggagcagcggattggggttgatgagttggtagtctac
gagacgggtgttatggaggggtttgagaagagttttggggaggcggttcgtgcttcggag
gagtttttggggggtggggtggagagggcggtttgggtggttgtgttttcgccgacgggg
tgtgatgctatggtgcgggtgttgaaggggcttggggatggggagaggagggtgtttgtt
gccacgattgggcctacgacgagggatcatttgaagaataagtatgggtttgaggcagat
gtttgtgctgagaaaccgagtcaggagggagtaggtatgggtattgtggaattcatggag
aatcggaggaagaatagggcagggcaatag

DBGET integrated database retrieval system