KEGG   Aspergillus oryzae: AOR_1_692154Help
Entry
AOR_1_692154      CDS       T01018                                 

Gene name
AO090003000402
Definition
mitogen-activated protein kinase
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
aor  Aspergillus oryzae
Brite
Enzymes [BR:aor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     AOR_1_692154 (AO090003000402)
Protein kinases [BR:aor01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   AOR_1_692154 (AO090003000402)
Exosome [BR:aor04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AOR_1_692154 (AO090003000402)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 354 aa AA seqDB search
MVQQLPPQGGSRKISFNVSDQYEIQDVIGEGAYGVVCSAIHKPSGQKVAIKKITPFDHSM
FCLRTLREMKLLRYFNHENIISILDIQRPRNYESFNEVYLIQELMETDMHRVIRTQDLSD
DHCQYFIYQTLRALKAMHSANVLHRDLKPSNLLLNANCDLKVCDFGLARSAASTDDNSGF
MTEYVATRWYRAPEIMLTFKEYTKAIDVWSVGCILAEMLSGKPLFPGKDYHHQLTLILDV
LGTPTMEDYYGIKSRRAREYIRSLPFKKKIPFKALFPKANDLALDLLERLLAFNPAKRIT
VEEALRHPYLEPYHDPEDEPTAPPIPEGFFDFDKNKDALSKEQLKILIYEEIMR
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagcaacttcctccccagggaggttcacgaaagatctccttcaacgtttccgac
caatatgaaattcaagatgtcattggtgaaggtgcctacggtgtggtgtgctctgccatc
cacaaaccatctggtcaaaaagtcgccatcaagaagatcactcctttcgaccactcgatg
ttctgcttgcgaactttgcgtgagatgaagctgcttcgctattttaaccatgaaaacatc
atctctatcctggatatccaaagaccacgcaactatgagagcttcaacgaggtttatcta
atccaggagctgatggagactgacatgcaccgggtcattcgtacccaagatctttcggat
gatcactgtcaatattttatttaccagactctacgtgccctcaaagctatgcactcggcc
aatgttcttcatcgtgatctgaaaccttcgaacctgctcctcaacgcaaattgcgatctg
aaagtttgcgattttggcttggcccgctcggccgcctccacagatgataactcagggttc
atgacagaatatgtggcgaccagatggtaccgtgcgccggagattatgttgacattcaag
gagtacaccaaagcgattgatgtgtggagtgttggttgtattctcgccgagatgctgagc
ggaaaacccttattccccggaaaggactatcatcaccaattgactcttattttggacgtt
cttggtacaccgacaatggaggactactatggaatcaaatcccgacgggctcgggaatac
attcggtctctccctttcaaaaagaagatccccttcaaggcgctcttcccgaaggccaac
gatttggccctggacctcctggagaggctcttggcattcaaccccgctaagcgtattact
gtggaagaagctttgcgtcatccatacctggagccgtatcatgaccccgaagatgagccc
acggcacctcccatcccggaagggttcttcgactttgacaagaataaggatgcccttagc
aaggagcagttaaagattctaatctacgaggagatcatgcggtga

DBGET integrated database retrieval system