KEGG   Aspergillus oryzae: AOR_1_696094Help
Entry
AOR_1_696094      CDS       T01018                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
aor  Aspergillus oryzae
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:aor00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AOR_1_696094
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 1667 aa AA seqDB search
MGDRDTLAGLRGLYQDLSSLTESSFVNIDRLRVELEAHIDDFRKLLDRPPKNNSSRQAVL
SGKITVDDLEYSINEEFQQGALQLADALGIDELEAAHLFLGAQDHAQMLDRTPLIAAIMR
FHERRHFLLESLRLILQESFEVEREMTQVLMQDMIAFVVEIKNGPLRNASLFARKCMKSM
EDIEKWLVLVAEQIQKASIVGQAEDADIMEAIEYQRASLQQQHESLGAILCYLFKGPYTS
PEDLRLLLVNLRKLDRFDGLLVHYIPSIIAAFVQHGSPESSNSYKEARSLHTAVTSTKDG
QSWALPTFHSAIIALWLAVYGGWDFDGPSSPLPGVDLEKDAEERTKMFMTALDDGGLDFM
LAVCSGVNNEEWADPARSELVTLLLKESSSAMPESDTCAPYMKCLLMENFEVFVESCIAN
MPDAVRMLKSEEDSQRLDQITALRDGLTSSLHRGLVEARTHLESFLMVMAFAFEQRPDAA
QEFWADPDGNLYGFLQWASKRQTVPRVSAFCELLCSISGSEDNATAAHRFLTEEDKFMSA
KFKRSTSMNWSQMFAELELYATKVTEKPPASTSQTILRSRKSEPADMSEPESPVMLTCYL
RLLGHLCRQSVAIRDWMLHHPSFNVVSTLLTLCSGPIPTHLRATVFATLAALMTERTPIN
GNEMWLSIDQWISGGSMSASGMGKIPVVSNPLVWHEQQAFQKFGESFDQANAFVTLINSL
VSPTSDSADYHLSLPFPESLGSSYRMPGIEPYIDFILGHALSRKLPDLNERQSRMLTYNC
LEFVVTCLKSFNESLVSVLSQPTVPSDVKTSSLVTYVRLHPFARVAEWLFNEDVIKAIFA
TAHQDIAEVSKAASDSILVLSVVRSLEVMDLIMDLQSTYFNIVRPLIKSQTGGSRTSVAN
SSLSAFEDSVLSNLSIVPALCLYCSTAHQQLTITSMVLLEKLSSSTKLNKVSSPGLAKWR
SSNKIVEVLSTEVEVDSVARPLVSQMQPEVRELDHGSQSSGYIIRESLLALLNSCLRMIT
DRPTIAHLLLGFSSVGNMLDISSDGLLANGMSLLHAIITFLQSYPDQVDGNILSWMVHLK
RMALEVLKHLWSSRISSYFTLTEMRASRFLQSLLASQPIIGPNTPWDGFPIMTEEFWISD
SASALAEFLLFRSYLYAYATTEVRSAAKLRSPTLQADIMSTLFGNSTSETGDAVLNPTVF
DLFDFADLDIGRQLQPPMLVLLDGIMLEACAKEADDSLVLYSEAELEELIQLRKEELLSS
GHLRPQDEDQFLAEAEGLKIFVHATNQSRKINNNRYLALRSWTELITTMLTCSEIEGGRK
STFILHTIQLILPKLEAAVEEDLPEATELARLAEVLVTKLESSATKANSARRSGDVIDEK
LHQLFQICVRGIALATGNVNLRETFYNICSSYIARIIQPDTGHESIKQHSHQIVKMAGTT
LIEAICDDAYAGQETCRVSALLFLNLLAALDKQGDSILAESISQSNYLSLFLDAIRTLPI
ELRNAQANDTPLLLSYYESLLSLLQQLCQTKAGATHVLKTGLFEAVRGSQLFAADPDLGI
DIDNPDALRRYYDLLDSVLRVIVSAAFSRGLHNEQMMEQTRAFLAENRQSMVGIFKRFAK
IGGGGAADHHNALTNLTKSYMALVAATDFLEFEDNEVRELAQPKLFS
NT seq 5004 nt NT seq  +upstreamnt  +downstreamnt
atgggggacagagacactctagcgggccttcgtggcttgtaccaagatctctcttccctc
actgagtcctccttcgtgaacatcgaccgtctccgtgttgagttggaggctcacatcgat
gatttcaggaagctccttgacaggccaccaaaaaacaattccagtcgccaagctgttctc
tcaggaaagatcaccgtcgatgatcttgaatattccatcaacgaggagttccaacaaggc
gcgttacagttggccgatgcgctgggtatcgatgaattggaggcagcacacctgtttctt
ggcgcacaggatcatgctcagatgctggacagaacacctcttattgctgcaatcatgcgg
tttcacgagcgtcgacacttcctcctcgaatctctgcgtcttatcctccaagagtccttt
gaggtcgagcgggaaatgactcaggtactaatgcaggacatgatagccttcgttgtcgag
ataaagaatggccctctacgaaacgcctcactgtttgcgcggaaatgcatgaaatcgatg
gaagatattgagaagtggcttgtacttgttgctgaacaaatccagaaagcatccattgtt
ggtcaagccgaagacgccgatataatggaggccatagagtatcagcgcgccagcttgcag
caacagcatgagtcattgggcgctatactttgctacctgttcaaaggcccttatactagc
cccgaggatcttcgactgctgcttgtaaaccttcggaaattggaccggtttgatgggcta
cttgtgcactatatcccttctattatcgctgctttcgttcaacatggttccccggaaagt
tccaattcatataaagaggcccgaagcttgcacacggctgttacttcgaccaaagatggc
cagtcctgggccctcccaactttccattctgcaataattgctctctggcttgcggtatat
ggtggatgggattttgacggaccgtcgtccccacttcccggggtcgatctcgagaaggac
gcagaggagcgcacaaagatgttcatgacagcgctggatgatggaggcctggacttcatg
ctggctgtctgctctggtgtgaacaacgaagaatgggcggatccagctcggagtgaattg
gttacattgctattgaaggaaagctcctcagctatgcctgagtcggacacttgcgccccc
tacatgaaatgcttactgatggagaacttcgaagtctttgtggagtcatgcattgctaat
atgccggatgctgttcggatgttgaaatctgaggaagactcgcaaagattggatcagatt
actgcgcttagagatggcctaacttctagtctccatcgaggtttagtggaagctcggaca
caccttgaatcattcctcatggtaatggctttcgcatttgagcagcgaccagacgctgca
caggagttttgggccgatcctgacggaaatctgtacggcttccttcaatgggcctcgaaa
aggcaaactgtccctagagttagcgcattctgtgaattactatgctctatttcgggcagc
gaagataatgccactgcagctcatagattcctcactgaagaggacaagtttatgtctgct
aaattcaagcggtcgacttctatgaactggtcccagatgttcgctgagctagaactttat
gcaacaaaagtcaccgagaagcctcctgcctcgacatctcaaacgattctacgatcccgg
aagtctgaaccagcagatatgagtgagccagaaagccctgtcatgttgacctgttatctc
cggttactgggacatctatgtagacaaagtgtcgcgatccgggactggatgcttcatcac
ccttcgttcaacgttgtcagcacattgttgacattgtgcagcggaccgatacccacgcac
ttgagagcaacagttttcgccacccttgcagctctaatgactgaaagaactcctatcaat
ggcaacgaaatgtggctttctattgaccagtggatttcaggtggatctatgagtgcttct
ggaatggggaagatcccagtagtctcgaatcctcttgtttggcatgagcaacaagcattt
caaaaatttggcgagagcttcgaccaagccaatgctttcgtgaccttgatcaattccctt
gtgtctccaacatctgattcagccgactaccacctctccctgccatttccagaatccttg
ggttcatcctatcgcatgccgggtattgagccttacatagactttatactgggccatgct
ttgtcacggaaattgccagatctcaacgaacgccaatctcggatgctgacatacaattgc
ctggagtttgtcgtgacatgcttgaagtccttcaacgaaagccttgtctctgttctcagc
caacccactgttccgtccgatgttaaaacgtcgtcattggttacttatgtccgcctacac
ccctttgcacgggtagccgaatggttgttcaacgaagatgtaatcaaggcaatcttcgcg
acagctcaccaagatatagctgaggtttccaaggcggcgtctgactctatattggtcctc
tctgtagtcagaagccttgaggtcatggatctaatcatggaccttcagtcgacgtatttc
aacattgttcgccccctgatcaagtctcaaactggtggaagccgaaccagcgtagcaaac
tcatcgctctcggcctttgaagatagcgtcctcagcaatttgtcaatcgtaccagctttg
tgtctttattgcagcacagcacatcaacaactcacaatcacatctatggtgctgctggag
aaactttctagctctacaaagctcaacaaggtttcatcacccggattagccaagtggcgc
tcctcaaataaaatcgttgaggtcctgagcactgaagtagaggtggacagcgtggcgcgc
ccgcttgtatctcaaatgcagcctgaagtacgggaacttgatcatgggtcgcaatcttcg
ggttacattattagagaaagtttattggcgctgctgaatagctgcctaagaatgattaca
gatcggcccacgatagctcatcttcttcttggatttagcagcgtgggaaatatgctcgac
atctcctctgacggacttctcgccaacggaatgtctttgctacacgctatcatcacattc
ttgcaaagctatccagaccaagttgatggaaatatcctgtcatggatggtgcacctgaag
cgtatggcattggaggtgttaaagcatttatggtcatctagaatctcttcctacttcacc
cttactgagatgcgtgcgagtcgtttcctgcaaagtctgcttgcaagccaacccatcatt
ggaccaaatactccttgggatgggttcccgattatgacggaagagttctggatttcggat
tcggctagtgctctcgcagaatttctgttgttcagaagttatttgtatgcttatgctact
acagaggttcgctcggctgctaagctccgttcaccaacgctgcaagcagatatcatgtcg
acattgtttggaaattcgacctccgagacaggggatgccgtcttgaatcctacggtgttt
gaccttttcgatttcgcggatctggacattggacgtcaacttcagccccccatgctggtc
ctactagatggtattatgctggaggcgtgtgcaaaagaggcggatgattcacttgtcctt
tacagtgaggcggagctggaggagctgatacaactcaggaaagaagagttgctttcaagc
ggacatttacgccctcaagacgaggatcaatttcttgcagaagccgaaggtctgaagata
ttcgtccatgcgacaaaccagtcaaggaagatcaataacaaccgttatctggctctccga
tcctggacggaactcattacgacaatgctcacttgctccgaaattgaaggtggacggaaa
tcgacattcatactgcataccattcaattgattcttcccaagcttgaagccgctgttgaa
gaggatcttcctgaggcgaccgaactagcacgcttagctgaagttttagttacaaaactg
gaatcaagtgcaacaaaagcaaattcggcccggagaagtggggatgtcatcgatgagaag
ctccatcaactcttccagatctgtgttagaggtatcgctctggcgacaggaaatgttaat
ctccgagaaactttctacaacatatgctcatcctacatcgcccgtatcatccagcccgat
acaggacacgagagtatcaaacagcatagccatcagattgtcaagatggctggcaccaca
ctgattgaagcgatatgcgatgatgcatatgctggtcaggagacatgtcgcgtgtctgct
ctattgttcctcaatctccttgcagccctcgataaacagggtgattcaatattggctgag
tcaatttcccagtcaaattacttaagtctcttcctcgatgccattaggacgttgcccatt
gaactcagaaatgcccaagcgaatgatacacctttactcttatcctattacgaatccctg
ctatctttgcttcagcaactctgccaaacgaaggcgggcgcaacccatgttctgaagacc
ggtctttttgaagcggtacgtggttcgcagctattcgctgccgacccagatcttggcatt
gatatcgataaccccgatgctctccggaggtattacgatctactggattccgttctacga
gtaattgtttccgccgcgttttcccggggcctgcacaacgagcaaatgatggaacagact
cgtgcgttccttgctgagaataggcaaagtatggtcggcatattcaaacgctttgccaag
atcggtggagggggtgctgccgatcaccataacgccctgaccaacctgaccaaatcatat
atggcactagttgctgctacggatttcttagagtttgaggataacgaagtgagagagctc
gctcagcccaaattattctcgtga

DBGET integrated database retrieval system