KEGG   Aspergillus oryzae: AOR_1_716184Help
Entry
AOR_1_716184      CDS       T01018                                 

Gene name
AO090009000434
Definition
alkaline phytoceramidase
Orthology
K04711  
dihydroceramidase [EC:3.5.1.-]
Organism
aor  Aspergillus oryzae
Pathway
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    AOR_1_716184 (AO090009000434)
Enzymes [BR:aor01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.-  
     AOR_1_716184 (AO090009000434)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 327 aa AA seqDB search
MPEWPAIPFFPYPPSKAGYWSPVTSTLNWCEEDYYATIYSAEIVNALTNLLFMWLGIKGL
RSCRRNGHDSIFEVAYYGYLLVGMGSFLFHSTLKYPMQLVDELSMIYTTCLMCYASFSYS
RPTSVRVFLAIALTSLAVFITLYYHYLQDPVFHQNAYAILTIVVVLRSMYTMEVTLRPKW
RHTTEEDRLAREKQGLPIPSKEHQHYENVRDVKILKTMWFMVIYGLSMFLGGFFIWNLDN
HFCTKIRGWRRVVGLPWGMLLEGHGWWHVMTGIGAYLYIIWGIWLRHCLNNRQEEYYLWW
PHFWNFPEIIRIGSKDKGENGVAKKSN
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagtggcctgccattcccttctttccatatccgccttccaaggctggctactgg
agtcccgttacgtcgaccttgaattggtgcgaagaggattactatgcgaccatctactcc
gccgaaattgtcaacgctttgacaaatcttctgtttatgtggcttggaattaaagggcta
cgcagctgtaggcgcaatggacatgattcgatctttgaagtggcatactatggctatctc
ctagttggaatggggagtttcctgttccattcgacactgaaatatcccatgcaacttgtc
gacgagctttccatgatctacaccacttgtttgatgtgctatgcgtccttttcttactcg
agaccgacaagcgtccgtgtcttcctagccattgcgctgaccagtctggccgtcttcatc
accctctattaccactaccttcaggaccctgtcttccaccagaatgcatatgctatcctg
accattgtcgtcgtcctgcggagtatgtacaccatggaagtaacccttcgccctaaatgg
cgacacactaccgaggaggaccggctagcgcgcgagaaacagggtctgcccattccttcg
aaggagcatcaacattacgagaatgtacgagatgtcaagattctgaagactatgtggttc
atggttatttatgggctgagcatgttcctcggcggcttctttatctggaacttggataac
cacttttgcactaagatccgcggatggcgccgggtagtggggcttccgtggggtatgctc
cttgaaggtcatggctggtggcatgttatgacgggtattggtgcgtacctctatataatt
tggggcatttggctgcgccactgtttgaacaaccgtcaagaggaatattacctgtggtgg
ccgcatttctggaactttccggagatcatccgtattggctccaaagacaagggcgaaaat
ggtgtggccaagaaatcaaattaa

DBGET integrated database retrieval system