KEGG   Aspergillus oryzae: AOR_1_724024Help
Entry
AOR_1_724024      CDS       T01018                                 

Gene name
AO090010000444
Definition
(RefSeq) 6-phosphofructokinase
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
aor  Aspergillus oryzae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AOR_1_724024 (AO090010000444)
   01230 Biosynthesis of amino acids
    AOR_1_724024 (AO090010000444)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AOR_1_724024 (AO090010000444)
   00030 Pentose phosphate pathway
    AOR_1_724024 (AO090010000444)
   00051 Fructose and mannose metabolism
    AOR_1_724024 (AO090010000444)
   00052 Galactose metabolism
    AOR_1_724024 (AO090010000444)
  Energy metabolism
   00680 Methane metabolism
    AOR_1_724024 (AO090010000444)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    AOR_1_724024 (AO090010000444)
Enzymes [BR:aor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AOR_1_724024 (AO090010000444)
Protein phosphatases and associated proteins [BR:aor01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AOR_1_724024 (AO090010000444)
Messenger RNA biogenesis [BR:aor03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     AOR_1_724024 (AO090010000444)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 775 aa AA seqDB search
MTNTILDTYSSRRKPRRIGILTSGGDAPGMNGAIRAVVRTAIQNGCEAWAIHEGYEGLIQ
GGAMMHPLYWEDVRGFLSRGGTLIGSVRCDRFREREGRLQAARNMVLFGIDALVVCGGDG
SLTGADLFRSEWPELLNELVSTGVLTVAQVAPHQNLNIVGLLGSIDNDFSGTDATIGCYS
ALTRICEAVDAVFDTASSHRRGFVVEVMGRHCGWLALMAAIATGADWLFIPERPPRDGWE
DDMCSIITKNRNRGKRRTIVILAEGAQDSNLDRISSSAVKDVLSKRLGLDTRVTVLGHIQ
RGGSPCAYDRWLSTLQGIHAVKAVLSMTPESPSPVVIIQENRIRTSSLAETVALTKEANA
SMHAKEFEKAATLRDPEFMEYHSAYRHLNTSDHPKMVLPEDKRMRVAIIHVGAPAAGMNP
ATRAVVAYCLTRGHTPIAIHNGFPGLCRHHDDTPGSVREMHWLESGDWINDGGSDIGTNA
GLPLDDIETTAQCFERYKFDALFVIGGFEAFTAVSQLRKARKQYLAFRIPLVLLPASMSN
NVPGTEYSLGSDTSLNTLVYFCDVVRQSASSSGHSVFVVEAQGAEYQATAAALAAGAMTV
YTPERGITLQSLSNDIEYLRQQFSKDHGANRSGKLIIRNDQTSTIYSTTEIANIIKHEAK
NRFDAQGVVPGHFQQGGKVSPIDRIRAFRLAVKCMEHLETFAGQSPEEIMNDENSATVIS
IKQSRILLLPMGGPTGVEATDTDWKRQRPKTQNWLEIQEAVDSLSGRSSLYAIPN
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacactatattagatacttactcttcaagacgcaaaccccgccgcattggcatc
ctgacatcaggaggggatgccccgggaatgaatggagcgatccgtgcagtcgtccgcaca
gcaatacagaacggctgtgaagcatgggcaatccacgaaggctacgagggactcatccag
ggcggtgcaatgatgcatcctttatattgggaagacgttcgaggtttcctatcccgtgga
gggacactcattggatccgtacgctgtgatcgttttcgcgaacgagaaggtcgtcttcag
gcggcaaggaatatggtgcttttcggcatcgacgccctagttgtctgtggtggggatgga
agcttgaccggggcagacctcttccgatccgaatggccagagctgctcaatgagctggtc
tcaacaggtgttttgaccgtggcgcaagtcgcacctcatcagaacctgaatattgtcgga
ctactcggctctatcgacaatgacttttccggcacagatgccaccattggatgctattct
gcattaacacggatctgcgaagcagtcgatgcagtgtttgacacggcttcttctcatcgc
cgagggtttgttgttgaagtcatgggccggcactgtggttggctagcgttgatggctgct
attgcaactggggcggattggttgtttatcccggagaggcctccgcgcgacggctgggag
gatgatatgtgttcaatcatcaccaagaaccgcaaccgtggcaaacgtcgcactatcgtt
attctggcagaaggtgcccaggacagcaacttggatcgcatttcgtcatctgccgtgaaa
gatgttctgagcaagcgcttagggctcgatacccgcgtcactgttctaggtcatatccaa
cgaggcggatccccatgtgcatacgaccgctggctatcaaccttacaaggcatccacgcc
gtcaaagcggtgctgtctatgactcctgagtcgccctctccggtggtgattatccaggaa
aatagaatcagaacatcgtctctggctgaaactgttgccttaacgaaggaggccaatgcc
agtatgcacgccaaagaattcgagaaagcagcaacacttcgggatcccgaattcatggaa
tatcatagcgcctaccgacacctgaacacgagtgaccatcccaagatggtcttacccgaa
gataagcgcatgcgggttgctatcattcacgttggcgccccagctgcaggcatgaatcca
gccacacgcgcagtagtcgcctattgcttaaccagaggacataccccgatcgccatccac
aacggtttccctggtctctgccgacaccatgacgatacccctggctcggttcgtgaaatg
cattggttggaatctggtgactggatcaacgacggcgggtctgacattggtaccaatgcg
ggactaccattagacgatatcgaaacgacagctcaatgcttcgagcgatataagtttgat
gcacttttcgttattggaggcttcgaagcgttcacagccgtcagtcaactgcgcaaggcg
cgaaagcaataccttgccttccggattccgctcgtccttctcccagcaagtatgtcaaat
aatgtccccggcacggaatactcccttggaagcgacaccagtcttaatacccttgtttat
ttctgcgatgttgttcggcaatctgcgtcctcctccgggcatagcgttttcgtcgtggaa
gcgcaaggagccgagtaccaggcgacagctgctgcgctggccgcaggagcaatgaccgtg
tatacgcctgaacgaggaataactctacaaagcctctccaatgatattgagtacctccgc
caacaattctcaaaggatcacggtgccaatcgctcgggcaagctgattatccgcaatgac
cagacatccaccatctacagtacaaccgagattgcaaatatcatcaaacatgaggccaag
aatcgctttgatgcgcagggcgtagtgcctggacacttccagcaaggcggcaaagtctca
cccattgaccgcattcgcgcgttccggttggccgtcaagtgcatggaacatttggaaaca
tttgcgggccagtctccggaggaaatcatgaacgatgagaactcagctacggtgatcagc
atcaaacagtctcgtatccttctgctgccgatgggaggtcctaccggagttgaagcgacc
gatactgattggaagcgacagcggccgaagactcagaactggttggagatccaagaagct
gtggactccttgtcaggacgctcgtctttatatgcgattccgaactga

DBGET integrated database retrieval system