KEGG   Aspergillus oryzae: AOR_1_772164Help
Entry
AOR_1_772164      CDS       T01018                                 

Gene name
AO090001000445
Definition
NADPH--cytochrome P450 reductase
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
aor  Aspergillus oryzae
Pathway
Fatty acid degradation
Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    AOR_1_772164 (AO090001000445)
  Amino acid metabolism
   00380 Tryptophan metabolism
    AOR_1_772164 (AO090001000445)
Enzymes [BR:aor01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     AOR_1_772164 (AO090001000445)
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     AOR_1_772164 (AO090001000445)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1103 aa AA seqDB search
MSTPKAEPVPIPGPRGVPLMGNILDIESEIPLRSLEMMADTYGPIYRLTTFGFSRCMISS
HELAAEVFDEERFTKKIMAGLSELRHGIHDGLFTAHMGEENWEIAHRVLMPAFGPLNIQN
MFDEMHDIATQLVMKWARQGPKQKIMVTDDFTRLTLDTIALCAMGTRFNSFYSEEMHPFV
DAMVGMLKTAGDRSRRPGLVNNLPTTENNKYWEDIDYLRNLCKELVDTRKKNPTDKKDLL
NALINGRDPKTGKGMSYDSIIDNMITFLIAGHETTSGSLSFAFYNMLKNPQAYQKAQEEV
DRVIGRRRITVEDLQKLPYITAVMRETLRLTPTAPAIAVGPHPTKNHEDPVTLGNGKYVL
GKDEPCALLLGKIQRDPKVYGPDAEEFKPERMLDEHFNKLPKHAWKPFGNGMRACIGRPF
AWQEALLVIAMLLQNFNFQMDDPSYNIQLKQTLTIKPNHFYMRAALREGLDAVHLGSALS
ASSSEHADHAAGHGKAGAAKKGADLKPMHVYYGSNTGTCEAFARRLADDATSYGYSAEVE
SLDSAKDSIPKNGPVVFITASYEGQPPDNAAHFFEWLSALKGDKPLDGVNYAVFGCGHHD
WQTTFYRIPKEVNRLVGENGANRLCEIGLADTANADIVTDFDTWGETSFWPAVAAKFGSN
TQGSQKSSTFRVEVSSGHRATTLGLQLQEGLVVENTLLTQAGVPAKRTIRFKLPTDTQYK
CGDYLAILPVNPSTVVRKVMSRFDLPWDAVLRIEKASPSSSKHISIPMDTQVSAYDLFAT
YVELSQPASKRDLAVLADAAAVDPETQAELQAIASDPARFAEISQKRISVLDLLLQYPSI
NLAIGDFVAMLPPMRVRQYSISSSPLVDPTECSITFSVLKAPSLAALTKEDEYLGVASTY
LSELRSGERVQLSVRPSHTGFKPPTELSTPMIMACAGSGLAPFRGFVMDRAEKIRGRRSS
GSMPEQPAKAILYAGCRTQGKDDIHADELAEWEKIGAVEVRRAYSRPSDGSKGTHVQDLM
MEDKKELIDLFESGARIYVCGTPGVGNAVRDSIKSMFLERREEIRRIAKEKGEPVSDDDE
ETAFEKFLDDMKTKERYTTDIFA
NT seq 3312 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcccaaggcagaacccgttcccatcccggggccgcggggtgtgcctctgatg
ggaaacatcctcgatattgagagcgaaatccctctaagaagcttggaaatgatggcagat
acttatggtcctatctatcggttaacgacctttggattctcacgttgcatgatcagctcc
cacgagctggcagctgaggtgttcgatgaggagcgttttaccaaaaagatcatggcaggc
ctcagtgagcttcgccacggtatccacgatggtttattcacggcccatatgggcgaggag
aattgggagattgcacatcgcgttttgatgcccgcctttgggcccctcaacatccaaaat
atgttcgatgaaatgcacgacattgcaacacagttggtgatgaagtgggctcgacaaggg
cctaagcagaaaatcatggtcacagatgatttcacccgccttacattggataccatcgcc
ctatgtgccatgggcacccgattcaattctttctatagcgaagagatgcatccctttgtg
gacgcaatggttgggatgttgaagactgcgggcgaccgctcccgtcgcccaggcttggtc
aacaacctgcctactactgaaaacaacaagtattgggaggatatcgactacctccgcaac
ctttgcaaggagcttgttgatacccgcaaaaaaaatcctacggacaagaaagatttgctc
aatgctctaatcaatggccgtgacccgaagaccggcaagggcatgtcatatgactccatc
attgataatatgatcactttcctgattgctggacatgaaaccacctctggttcgctttcg
ttcgccttctacaacatgctcaagaacccccaggcatatcagaaagctcaggaggaagtg
gacagagtcattggacgccgcaggattaccgtcgaggacctgcaaaagctgccttacatt
actgctgtcatgcgtgaaaccttacgactcacccctactgcacccgctattgcagtcggc
cctcacccgaccaagaaccacgaggaccccgtcactcttggtaacggaaaatatgttctt
ggcaaagacgagccatgtgctctcttgttgggcaagattcagcgtgatcccaaggtgtac
ggccccgatgcagaggaattcaagccagagcggatgctggatgagcatttcaacaagctg
cctaagcacgcgtggaaacctttcggaaacggaatgcgagcatgtatcggtcggccgttt
gcctggcaggaagcgctcctcgtcattgcgatgttgttgcaaaacttcaacttccagatg
gatgatccgtcctacaacattcaactcaagcagacgctcaccatcaagcccaatcatttc
tatatgagagctgctcttcgcgagggcttggacgctgtgcacctaggatcagcattgagc
gctagcagcagcgagcatgcggatcacgctgccggccatggtaaggcaggcgccgctaag
aagggtgccgatttgaagcctatgcatgtatactacggtagcaacactggaacctgtgag
gcctttgcaagacgcctcgccgatgatgccactagctatggctactcggctgaggttgaa
tcgctagattcggccaaagatagcatccccaagaatgggccggttgttttcatcaccgcg
tcctatgaaggacagcccccagataatgccgcccatttcttcgagtggctcagcgctttg
aagggcgacaaacccttggacggcgttaattatgctgtgttcggctgtggacatcacgat
tggcagacaactttctaccgcattcctaaggaagttaaccgccttgttggcgagaatggc
gcaaataggctctgcgagatcggtctggccgacacagccaacgctgatatcgtcacggat
ttcgatacctggggtgaaacttcgttttggccagcagttgccgctaaattcggttcaaac
acccagggctcccagaagtcatccaccttccgtgtagaggtcagctcgggtcacagagca
actaccctcggtctccaactgcaagaaggtcttgtcgtggagaacacgctcctcactcag
gctggcgtgcctgccaagcggactattcgcttcaagctccctactgatacgcagtacaag
tgcggtgactacctggccatccttccagtgaaccccagcactgtagtccgcaaagtcatg
agccgtttcgatcttccctgggacgccgtactccgcatcgagaaggcatctccctcatcc
tcgaaacacatttccatcccaatggatacccaagtctccgcctacgacctgttcgccacc
tacgtcgaactctcgcagcccgcatcgaagcgtgacctagcagtcctcgccgacgcagca
gccgtagaccccgaaacccaagccgaactacaggcgatcgcctccgacccagcccggttc
gccgagatctcccagaagcgcatcagcgtactggacctactgcttcaatacccctccatc
aacctcgcgatcggagacttcgtagccatgctccctcccatgcgtgtccgccagtactcc
atctcctcctcccccttagtcgaccccaccgaatgctccatcaccttctccgtcctgaaa
gccccatccctcgccgccctcaccaaagaagacgaatacctcggcgttgcatcaacctac
ctttccgaactccgctccggcgaacgcgtccaactctccgtccgcccctcgcacactggc
ttcaagccccccaccgaactcagtaccccaatgatcatggcctgcgccggcagcggcctc
gcccccttccgcggcttcgtgatggaccgcgccgagaaaatccgcggccgtcgcagctcc
ggctccatgcccgaacaacccgctaaagcgatcctctacgccggctgccgcacccaaggc
aaggacgacatccacgccgacgagctggccgaatgggagaagatcggtgccgtggaagtc
agacgggcctacagccgtcccagcgacgggtcgaagggcacacacgtgcaggatctcatg
atggaagataagaaggagctcattgatctctttgagagcggggctaggatctatgtctgt
ggtacgccgggcgttggtaatgccgtccgggattcgattaagagtatgttcctcgagaga
cgggaggagattcgtcgcattgcgaaggagaagggcgagcctgtttcggacgatgatgag
gagacggcgtttgagaagttcttagatgacatgaagactaaggagcggtatactacggat
atttttgcttaa

DBGET integrated database retrieval system