KEGG   Aspergillus oryzae: AOR_1_786014Help
Entry
AOR_1_786014      CDS       T01018                                 

Gene name
AO090026000426
Definition
cAMP-dependent protein kinase type 2
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
aor  Aspergillus oryzae
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:aor00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    AOR_1_786014 (AO090026000426)
Enzymes [BR:aor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     AOR_1_786014 (AO090026000426)
Protein kinases [BR:aor01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   AOR_1_786014 (AO090026000426)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 464 aa AA seqDB search
MPSLGGLLKKRRTKDSQTLSKELEAGSSPTAAQTQTSPNQHHHSHQSHPTPTATSPDVAY
TSAQPHQSSHDHHNCSSGTNQSHPEGQPSSMQSAVTQSPPAHHHHGHHHTNSHNVASIQN
IIHSSHQSGQSVGGGSQQSQTRTTKGKYSLEDFSLQRTLGTGSFGRVHLVQSKHNHRFYA
VKVLKKAQVVKMKQIEHTNDERRMLNRVRHPFLITLWGTWQDSRNLYMVMDFVEGGELFS
LLRKSQRFPNPVAKFYAAEVTLALEYLHSHQIIYRDLKPENLLLDRHGHLKITDFGFAKE
VPDITWTLCGTPDYLAPEVVSSKGYNKSVDWWSLGILIFEMLCGFTPFWDSGSPVKIYEN
ILRGRVKYPPYLHPDAVDLLSQLITADLTKRLGNLHGGPEDVKNHPWFAEVTWDRLARKD
IDAPYVPPIRGGQGDASQYDRYPEEQEAYGQSGEDIHGHLFPDF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgccgagcttaggaggcttattgaagaaacggcggaccaaggattcgcagaccctcagc
aaagagcttgaagccggttcgtcacccacagcggcccagacgcagacgtcaccaaaccag
catcaccacagccaccaatcccatcccactcctactgccacctccccggacgttgcttat
acctctgcgcaacctcaccaatcgtcccacgatcatcacaattgctcttcaggcactaat
caaagccaccccgagggtcaaccatcctccatgcaatccgccgtgacgcaatctcccccg
gcccaccatcaccatggtcaccaccacaccaactcccataatgtcgccagtatacagaac
ataattcattcatcccatcagagcggccagtcggtcggcggaggttctcaacaatcgcag
acccgaaccaccaagggcaagtactctctcgaggatttcagcctccagcgcacattgggc
accggtagctttggtcgagtccatctcgtgcagtccaagcacaaccaccgcttctatgcc
gtcaaagttctgaagaaggcccaggtggtcaagatgaagcagattgagcatactaatgac
gagcgacgaatgctcaatcgcgtcaggcatccgttcttgatcaccctatggggcacatgg
caggattcgcgaaatctgtacatggtcatggattttgttgagggaggtgaactcttcagt
ctgcttcgcaagtctcagcgattccctaaccccgtggccaagttctacgccgcggaagtc
actcttgcgctggagtatctgcactctcatcagattatctatcgagatctgaagccggag
aacttacttctcgaccggcatggccacctgaagatcaccgactttggttttgcgaaggag
gtgcccgatatcacctggaccctgtgtggcacgcccgattatttggctcccgaggttgtt
tcatccaagggttacaacaagtcggtggactggtggtcccttggaatcctgatcttcgaa
atgctgtgtggcttcacacccttctgggacagcggatcgccggtcaagatctatgagaac
atcctccggggtcgggtaaaatacccaccttacctgcacccagatgctgtggatctactt
tcccaactgatcacagcagacctaaccaagcgcctgggcaacttgcatggtggtccggaa
gacgtcaagaatcatccgtggttcgccgaagtcacctgggaccggctggccaggaaagac
atcgatgctccctatgtaccaccgattcggggaggacaaggcgatgcaagccagtatgac
cgctacccggaagaacaggaagcctacggtcaaagtggcgaggacattcacggccatttg
ttccccgacttctaa

DBGET integrated database retrieval system