KEGG   Aspergillus oryzae: AOR_1_796024Help
Entry
AOR_1_796024      CDS       T01018                                 

Gene name
AO090010000483
Definition
1,4-alpha-glucan-branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
aor  Aspergillus oryzae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AOR_1_796024 (AO090010000483)
Enzymes [BR:aor01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     AOR_1_796024 (AO090010000483)
Exosome [BR:aor04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AOR_1_796024 (AO090010000483)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 689 aa AA seqDB search
MGTSQAVDSSPPDGTGVIQLDPWLEPFRDALKQRFSFIEGWVKAINETEGGLETFSKGYE
RFGLNVQSNGDIIYREWAPNAVQAQLVGEFNNWDVTAHPMTKNGFGVWEVTVPAVNGAPA
IPHDSKIKISMVIPSGERIYRIPAWIKRVVQDLSVSPTYEAVFWNPPTEKQYKFQYSRPK
RPESLRIYEAHVGISSPETKVATYKEFTSNMLPRIKYLGYNAIQLMAIMEHAYYASFGYQ
VNNFFAASSRYGTPEDLKELVDKAHSMGLVVLLDVVHSHASKNVLDGLNMFDGTDHLYFH
GGGKGRHELWDSRLFNYGHHEVLRFLLSNLRFWMEEYGFDGFRFDGVTSMLYTHHGIGTG
FSGGYHEYFGSSVDEEGVMYLTLANEMLHNLYPNCITVAEDVSGMPALCLPHSLGGVGFD
YRLAMAVPDMYIKLLKEKKDDEWDIGNLSFTLTNRRHGEKTIAYAESHDQALVGDKTLMM
WLCDKEMYTHMSVLTEFTPIIERGMALHKLIRLVTHGLGGEGYLNFEGNEFGHPEWLDFP
RDGNNNSFWYARRQLNLTEDHLLRYKFLNDFDRAMQLTEEKYGWLHSPQAYVSLKNETDK
VLVFERAGLLWIFNFHPTNSFTDYRVGVEQSGTYRIVLDTDDPAFGGLNRNLKETRFFTT
DLSWNGRSNFLQVYIPTRTALVLALEETL
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgggtacctcccaagctgtggatagctccccgccggatggtacaggtgtcatacagctg
gacccttggctggagccttttcgtgatgctttgaagcagaggtttagtttcatcgaaggc
tgggtgaaggccatcaatgagacagaaggaggtcttgaaacgttcagcaagggttacgag
aggtttggcctcaacgttcaatccaatggtgacattatatacagagaatgggctccaaat
gctgtgcaagcacaattggtcggagaattcaacaattgggatgtgacggcccacccaatg
acaaagaatggctttggcgtctgggaggttacggtgccagcagttaacggcgctccagct
attccccacgatagcaaaatcaagatatccatggtcatccccagtggagagcgaatctat
cggatcccagcgtggatcaagcgtgtggtgcaagacctcagtgtgtcacctacatatgag
gcggtcttctggaatcctccaaccgaaaaacaatataagtttcagtattcccgccctaag
aggcctgaaagtctacggatctatgaggcacatgtgggaatttcatcaccagaaactaaa
gtcgcaacttacaaagagttcacttccaacatgctccctcggattaaatatctggggtac
aatgcaattcaactaatggccatcatggagcacgcttactacgccagcttcggataccaa
gtcaataacttcttcgcagcgagcagccgctatggtacgcctgaagacctgaaggagctc
gtcgataaagcccacagcatgggactagtggtgctcctcgatgtcgtccacagccatgcg
tcgaagaacgtgcttgatggattgaacatgttcgacggtacagaccacctatacttccac
ggcggtgggaagggtcgacatgagttgtgggacagtcgcctatttaactacggccatcat
gaggttctgcgcttccttttgagcaacttacgcttttggatggaagagtatggctttgat
ggtttccgcttcgatggtgtcacaagcatgctttacacccatcatgggattggaacaggc
ttttctggggggtaccatgagtacttcggttcttctgtcgatgaagaaggtgtgatgtat
ctaactcttgctaacgaaatgctccataacctctatcccaattgtatcacagtagcggaa
gacgtctctgggatgccggcactctgtctaccacactccctgggcggagttggctttgac
taccgcctcgccatggccgtcccagacatgtatatcaagctcttgaaagagaagaaggac
gacgagtgggacataggaaacctatccttcacgctgacgaacagacgccatggcgagaag
acgattgcctacgcagaaagccacgatcaagcgcttgttggcgataaaaccctcatgatg
tggctatgcgacaaagaaatgtacacacacatgtccgtgctaacagaattcacacccatc
atcgaacgaggcatggccttgcataagttgatccgattagtcacacatggtctcggaggt
gaaggctacctcaacttcgaaggcaacgagttcggacacccggaatggcttgacttcccc
cgagatggaaacaataactccttctggtatgcacgacgtcagctaaatctgaccgaagac
catcttctgcggtataaattcctcaatgatttcgaccgtgcgatgcaattgacagaagaa
aaatacggatggctccattcgccacaggcatatgtcagcctaaagaacgaaaccgacaag
gtcctcgtctttgagcgggctggtcttctctggattttcaacttccacccaaccaatagc
ttcaccgactaccgtgttggggtcgagcaatcaggcacgtaccgtatcgtcctcgacacc
gatgacccagcattcggtggtctgaaccgcaatcttaaggagacacggttttttaccacc
gatttatcgtggaatggccggagcaacttcctccaagtctacatccctaccaggaccgca
ctagtcctggccttagaggaaacgctgtag

DBGET integrated database retrieval system