KEGG   Aspergillus oryzae: AOR_1_800134Help
Entry
AOR_1_800134      CDS       T01018                                 

Gene name
AO090102000492
Definition
asparaginase
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
aor  Aspergillus oryzae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 539 aa AA seqDB search
MATIDDIIPEMIERQLEPQLPEARVLIIMTGGTICMRPSPSGFIPARGFQEQCLARVPTF
NDGSPSTMMDVVVDNTGQIKGHQSLRTPQTAYGRRVRYTVFEFEELLDSSSIDAKGWAEI
ARTVERNYTLFDAFVILHGTDSLAYTSSALSFMLQNLGKTVILTGSQAPMLELQNDATDN
LLGSLVVAGHFMIPEVAASDFAAFDSPNCTPLAVTTSMRTNVNWELVNRPKGIEHFSIQT
HLDTTHVACLRIFPGIKPEMIDAVLRLDGLRGLVLETFGAGNAPHGQDNALIKVLADAIK
RGIVIVNVTQCLTGSVSPVYATGMSLSRAGVVAGLDLTTEAALTKLAYLLGLPDATPESV
ARDMSKSLRGELTEVSQPVFRHPDGALTERVQALTILGYAIAQGDLTRVEEILKLENHYL
LNDADYSGNTPMHLAATSPSLSILRFLLMQGGSVHIRNRNNRTPLFLAANAGLSEHVMLL
RKSGAHLHSDERTAAQLLARRRPGVWGLAGIGPREVSDREMEEVGEERLAERVMAGSAP
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccatagacgatatcattcctgagatgattgaacgacagttagaacctcagctc
cctgaggcgagggtccttatcattatgaccggaggtaccatatgtatgcgaccgtcacca
tcagggtttataccggcgcgagggttccaagagcaatgcctggcccgggtgcctactttc
aatgatggttctccttcgaccatgatggatgttgttgtcgataacacaggccagatcaag
ggccatcagagtctacggacaccacagactgcatacggccgccgagtaagatatacggta
tttgagtttgaggagctgctggacagcagttctattgatgccaaaggctgggcagaaatt
gcacggaccgtcgagaggaactacacactttttgacgcattcgtcatccttcacggtaca
gatagtctagcatacactagctctgcactcagcttcatgctgcaaaatctggggaaaacc
gtaatcctcacgggatcccaggctccgatgttggagcttcagaatgacgcgacagataac
cttcttgggtccctggttgtggctggccacttcatgattcccgaagttgcggcaagtgac
ttcgctgcatttgattctccgaattgcacaccgttggctgtgaccacttccatgcgcact
aacgtcaactgggagttggtgaatcggccaaagggcatcgagcatttcagcattcagaca
catctagatactacccatgtcgcctgtcttcgtatattccctggtatcaagccagaaatg
attgatgccgtgttgagactagacggactccgtggtttagtgttagagacctttggagct
ggtaacgcaccacacggtcaagataacgctttgattaaagtgcttgcggatgccatcaag
cgagggattgtgattgttaacgttactcaatgtttgactggcagcgttagcccggtatat
gccaccggtatgagcttgtctcgggctggtgttgtcgcaggtctcgacttaactacggaa
gccgccctaacaaaactggcgtatctccttggtctaccagacgcaaccccggagtccgtg
gcacgggacatgtcgaaatcactccgaggagaattgacggaggtttcgcagcccgtattc
cgtcatccagacggcgctctcaccgagcgtgtccaggcacttaccattttgggctatgcc
atcgcccagggagatctcacacgtgtcgaagagatcctgaagctggaaaatcactacctt
ttgaacgatgccgattactccggcaatactccgatgcatctggccgcgacatcgccatca
ctctccatcctgcgcttcctactgatgcagggtggttccgtccacattcggaatcgcaac
aaccgcacaccactgttcctggcggccaacgcaggcttatcggagcatgttatgttgttg
cgcaagtcgggcgcccatttgcactcggatgaacggactgcggcacaattgctcgcgcga
cgcagaccgggagtctggggattggcggggattggaccgcgggaggtcagtgaccgtgag
atggaagaagtaggagaggagcgactggcggagcgagtgatggccggatcggcaccgtga

DBGET integrated database retrieval system