KEGG   Aspergillus oryzae: AOR_1_800174Help
Entry
AOR_1_800174      CDS       T01018                                 

Gene name
AO090005000456
Definition
acyl-CoA desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
aor  Aspergillus oryzae
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:aor01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:aor01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 456 aa AA seqDB search
MSAKTADATQPRAGDIKKVHIADTAITRSNWHKHVNWLNVFLIIGIPMYGCVQALWVPLQ
LKTAIWAVIYYFFTGLGITAGYHRLWAHCSYSARLPLRIWLAAVGGGAVEGSIRWWARDH
RAHHRYTDTEKDPYSVRKGLLYSHLGWMVMKQNPKRIGRTDISDLNEDPVVVWQHRNYLK
VVFTMGLFVPMLVAGLGWGDWWGGFVYAGILRIFFVQQATFCVNSLAHWLGDQPFDDRNS
PRDHVITALVTLGEGYHNFHHEFPSDYRNAIEWHQYDPTKWSIWIWKQLGLAYDLKQFRA
NEIEKGRVQQLQKKIDQKRAKLDWGVPLDQLPVMEWDDYVEQAKNGRGLIAIAGVVHDVT
DFIKDHPGGKAMINSGIGKDATAMFNGGVYYHSNAAHNLLSTMRVGVIRGGCEVEIWKRS
QKESTDYVRDSSGQRVIRAGEQVTKIPEPIPTADAA
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcaaagacggcagacgctacccagcctcgtgctggcgacatcaagaaggttcac
attgccgacactgccatcacacggagcaactggcataagcatgtcaactggctgaacgtg
ttccttattatcggcattcctatgtatggatgtgtccaggctctctgggtgcctctgcag
ctcaagactgctatctgggccgtcatctactacttcttcaccggactgggtatcaccgca
ggataccatcgtctgtgggctcactgctcctattccgctcgccttcccctccgtatctgg
ctcgctgctgttggcggtggtgccgtggaaggttctatccgctggtgggctcgtgaccac
cgtgctcaccaccgttataccgataccgagaaggatccctactcagtccgcaagggtctg
ctctactcccaccttggctggatggtgatgaagcagaaccccaagcgtattggccgtact
gatatctccgatcttaacgaagaccccgtcgttgtgtggcaacaccggaactacctcaag
gtcgtcttcaccatgggtctgtttgtgcctatgctcgtggccggtctgggctggggtgac
tggtggggcggtttcgtctatgctggtatcctccgtatcttcttcgtccagcaggcaact
ttctgcgtcaactccttggctcactggcttggtgaccagccatttgatgaccgcaactct
cctcgtgaccacgtcattactgccctcgtcaccctcggtgaaggataccacaacttccac
cacgaattcccctccgactaccgtaatgctatcgaatggcaccagtatgatcccaccaag
tggagcatctggatctggaagcagcttggcctcgcctatgatctcaagcaattccgtgcc
aacgagatcgagaagggccgtgttcagcagctccagaagaagatcgaccagaagcgtgcc
aagttagactggggtgtccctctcgaccagcttcccgttatggagtgggacgactacgtc
gagcaggccaagaatggccgtggtcttattgccattgccggtgttgtccacgatgtgact
gacttcatcaaggaccaccccggtggcaaggctatgatcaactctggtatcggcaaggat
gccaccgctatgttcaacggaggtgtctactatcactccaacgctgcgcacaacctgctg
tcgaccatgcgggttggagtcatccgcggtggctgtgaagtcgagatctggaagcgctcc
cagaaagagagcaccgattacgtccgtgacagcagcggtcagcgggtcatccgcgctggt
gaacaggttacgaagattccggaacctatccccactgctgatgcagcatga

DBGET integrated database retrieval system