KEGG   Aspergillus oryzae: AOR_1_802094Help
Entry
AOR_1_802094      CDS       T01018                                 

Gene name
AO090120000455
Definition
agmatinase 1
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
aor  Aspergillus oryzae
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    AOR_1_802094 (AO090120000455)
Enzymes [BR:aor01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     AOR_1_802094 (AO090120000455)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 392 aa AA seqDB search
MLVTTVSLLALSAVASAHGKHQTPMSGPHQKLWYNTLPGDGGTQADSVFSGISTFARLPY
FPCLSSEDEKYDIAFIGAPFDTGTSYRPGARFGPSGIRQGSRRLNLYGGYNVPLEANPFV
SDLKVIDCGDIPVTSYDNAWAIQQIEEGHNSILMRKPFTDANEYGLSRAGKTLPRVITLG
GDHTITLPLLRSINKAYGPVSVIHFDSHLDSWKPKVFGGSPSQVASVNHGTYFYHAAMEG
LLKNDTNIHAGIRTTLSGPSDYENDGYCGFEIVEAREIDTIGTDGIIKRIRDRVGTENPV
YLSIDIDTLDPAYAPATGTPETGGWSTRELRTIIRGLDGLNLIGADIVEVAPAYDTNAEL
STMAAADVLYEILTMMVKKGPLTVDSDGSVDL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgctcgtcacaacagtgagccttctcgctctgtctgctgtggcttccgcccatggcaag
caccaaacccccatgtctggtccgcaccagaaactgtggtataacaccttgccaggagat
ggtggtactcaggccgattctgtcttctcaggcatttcgactttcgctcgcttgccctac
tttccctgtctctccagcgaggatgagaagtatgatattgccttcataggtgcccccttt
gacaccggcacctcctacagacccggtgccagatttggtcccagcggcatcagacaaggc
tcacgccgtctcaatctctacggtggctacaacgtccccctagaagccaacccctttgtc
agtgatctgaaagtcatagactgcggcgacattcccgtcacctcctacgacaacgcctgg
gcaatccagcaaatcgaagaaggccacaacagcatcctgatgcgtaagcccttcaccgac
gcaaacgaatatggcctctctcgagcaggcaagaccctcccccgcgtcatcaccctagga
ggtgatcacaccatcacgctgcccctgctgcgcagtatcaacaaggcctatggccccgtc
agtgtcattcacttcgatagccatctcgactcctggaaaccaaaggtcttcggtggctcc
ccaagccaggtcgcttccgttaaccatggaacttacttctaccatgcggcgatggaaggc
cttcttaagaacgacacgaatattcacgctggtatccggactactctttcaggtccctcg
gattatgagaatgatggatactgtgggtttgagattgtagaggctagggagattgacaca
atcggcacggacggtataatcaaaagaatccgcgaccgcgtcggtaccgaaaaccccgtt
tacctctccatcgacatcgacacgctggatcctgcctatgcccccgcaaccggcacccct
gaaacaggtggctggtcaacccgcgaactgcgcacgatcatccgtggtctagacgggttg
aatctcatcggggccgatatcgtggaggttgcacctgcttatgatactaatgcggagctg
tcgactatggctgccgcggatgtgctttatgagattcttacgatgatggttaagaagggg
ccgttgactgttgattctgatggatctgttgacttgtag

DBGET integrated database retrieval system