KEGG   Aspergillus oryzae: AOR_1_818014Help
Entry
AOR_1_818014      CDS       T01018                                 

Gene name
AO090026000444
Definition
histone acetyltransferase type B catalytic subunit
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
aor  Aspergillus oryzae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 511 aa AA seqDB search
MASEGDWTCDANDAVQITLVQPGEQKPKTLSSFHPQFTYPIFGDDETIFGYKGLIIRLRF
AAHDLRPHIHISYDEKFKTVGDTSAVDLIKTLSPFIPEEAFSTLPDYENAVQEDKDAKDF
VPPGKLVHNYVTRGRTYEIWAASLADPQVRRLLDRAQVFVSLFIEAGTPLETEDPEWTLE
RWTVYFVYEKVKPPTPTASQYSIVGYATTYRWWFYQRDSPEKGTVTNDPFPGPEIRPAQL
PARLRIAQFLILPPHQGSGHGTHLYTTIHTACFNDSTIVELTVEDPNEAFDALRDTADFH
ILRPEFLKHNVNINPDPYAELSKKQRPRRVPTSALIPTKLLHDIRSTYKIASTQFAHVLE
MFLLGEIPTKNRHAGGANMSRLLVKKYNATDPNERRYYWWRMLVKQRLFKRSRDILIQLE
MSDRIEKLEETVTNVEEGYEALIKVFTAREEALMAKQEESGESPETAVLEDSVASSSDSS
TRDQRTKRKFTVEDEDEEEEGESEVSKRPKV
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcgaaggcgactggacctgcgacgctaatgacgccgtccagatcactcttgtc
cagcctggtgaacaaaaaccgaagacgctctctagcttccatccacagtttacttaccca
atttttggtgatgacgaaacaattttcggttacaagggattgatcatccgcttgcgattc
gctgctcatgaccttcgtccgcatatccatatttcctacgatgaaaagtttaagaccgtg
ggcgacacctcagcagttgacttgatcaaaacattaagcccattcattccggaagaggct
ttctccacccttccagattatgaaaacgccgtccaagaagacaaagatgcaaaggacttt
gtaccgccaggaaagctcgtccataactatgtcactcgaggacgaacatacgagatctgg
gcggcatctcttgctgatcctcaggtgcgacggctgttggaccgagctcaggtcttcgtg
tcactattcattgaggctggtacaccattagaaacggaggatcccgaatggacacttgag
cgctggacggtctacttcgtgtacgagaaagtgaaacccccaactcccactgcttcacaa
tattccatcgtcggatatgcgacaacctatcgctggtggttctaccaaagggattcccca
gagaaaggcacggtcacgaatgacccattcccaggtcccgaaatacggcctgcacagcta
ccagcccgactgcggattgcccagttcctgattcttcctcctcaccaaggctcgggacat
ggtacccatctgtatacgaccattcataccgcttgcttcaatgattcgacaattgtcgag
ttgacagtcgaagaccctaatgaagcgtttgacgcgctccgcgacaccgcagatttccac
atcctgcgcccagaattccttaaacacaacgtgaatatcaaccccgacccctacgcagaa
ctttctaagaaacagcgaccccgtcgcgtcccaacatctgccctcattcccacaaagctt
ctccacgatatccgttccacctataagattgcctcaacacagtttgctcatgtcttggag
atgtttctcttgggcgagattcccaccaagaatcgtcatgctggtggcgcaaatatgtca
cgtctattggtaaagaaatataatgccacggacccaaacgagcggcggtactactggtgg
cgcatgctagttaaacaacgtctcttcaagcggtctcgtgatattctcatccagctagag
atgagcgaccgcatcgagaaacttgaggagacagtgaccaacgtggaggaaggatacgaa
gcattaatcaaagtctttactgccagagaggaggctctaatggctaagcaagaagaatct
ggcgaatcgcccgaaactgcagtcctagaagactcagtcgcaagttccagtgattcatcg
accagagatcagcgcactaaaagaaagtttacagtagaggatgaggatgaggaggaagag
ggtgaatcggaagtttctaagcgtccgaaggtgtaa

DBGET integrated database retrieval system