KEGG   Aspergillus oryzae: AOR_1_82144Help
Entry
AOR_1_82144       CDS       T01018                                 

Gene name
AO090023000047
Definition
tannase subunit
Orthology
K10759  
tannase [EC:3.1.1.20]
Organism
aor  Aspergillus oryzae
Brite
Enzymes [BR:aor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.20  tannase
     AOR_1_82144 (AO090023000047)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 573 aa AA seqDB search
MRSALNILAGAATLTVAQAASLSDVCTNSHVKSALPSIDLINGLVIDPSSITTNAVYNAS
TPGGDYFPAASAYDFCNVTLTYAHPGRNDRVHLKLWMPAPDQFQNRWLSTGGGGFAINHD
EQQLPGGVQYGAAAGITDGGFGSFYTQFDQVFLLANGTINYEALYMFGYQAHHELSVIGK
ALTKNFYGTGDAKLYAYWQGCSEGGREGFSQVQRFQEFDGAVIGAPALRYGQQQANHLYG
NLVEHTLKYYPPPCELEKIVNLTITACDRLDGRSDGVVSRTDLCKLHFNINSTIGAPYSC
PASTTTTGTTPAQNGTVSALGAAAARKMLDGLRTLDSRRAYIFYQPSATFDDAQTKYNPE
TKQFELEVSAYAAEWIPRFLQLQNYTLSSLENVTYDTLKDWMELGWQRYEDVLQTTWPDL
TPFQSAGGKVLHYHGESDPSIPAGSSVHYHESVRKTMYPNMSFNESNQALNEWNRLFLVP
GAAHCASSTDQPNGPFPQATLKTLIEWVENSIVPETLNGTVLDGDHKGEQQQICAWPLRP
LWTENGTVMNCVYDQASLDTWDYEFDAYRIPLY
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgaggtcggcgctaaacatcctcgcgggagcagccactctcacagtggcacaggctgct
agccttagcgatgtttgcacgaacagccatgtcaagtcggctctgccctccattgacctc
atcaatggtcttgtaattgatccatcttctattaccaccaatgccgtctacaatgcttcc
acccccggaggtgactacttcccagcagcatccgcctatgatttctgcaacgtgactctc
acgtacgcccaccctggacgcaatgatcgagttcatcttaaattatggatgccagctcca
gaccagttccaaaaccggtggctatccactggtggaggtggttttgcgatcaatcacgac
gaacagcagcttccgggtggtgttcaatatggcgccgcggctggcatcactgacggaggt
ttcggcagcttttacacccagtttgaccaagtattcctgctggccaatggcacgatcaac
tatgaagcactttatatgtttggctaccaggcgcaccatgagctgagtgtcatcggaaag
gctttgacaaagaacttttatggcacgggagacgcaaaactgtatgcctattggcaggga
tgctccgagggtggtcgcgagggattcagccaggtgcagcgatttcaggagttcgacggc
gcagtgatcggcgcccctgcccttcggtatggccaacaacaggccaaccatctgtatgga
aacttggttgagcatacactcaagtactaccctccgccctgtgaattggagaagatcgtt
aatttgaccattacggcatgcgatcgcctggatggaaggtcggacggtgtggtgtcgcgg
accgacctgtgcaagctgcatttcaatatcaattcaacgattggagcaccctactcctgc
ccagcctcaacgacaacaactggtacaaccccggcgcagaacggaaccgtgtctgcgctc
ggtgcagcagcagccaggaagatgttagatggccttcgcacccttgacagccgtcgggcc
tatatcttctaccagccttccgccaccttcgatgatgcgcaaacgaaatataaccccgaa
accaagcaattcgaactcgaggtctctgcctatgccgccgaatggatcccccgcttcctg
cagctacagaattacactctatcttccctggaaaacgtaacatacgacaccttaaaagac
tggatggaacttggatggcagcgctacgaagacgtcctgcagaccacatggcccgattta
actcctttccagtccgcgggtggaaaggtgcttcactaccatggtgaatcggatccaagt
attccggctggatcctcggtacactatcatgagtctgttcgtaagactatgtaccccaac
atgtctttcaacgaaagtaaccaggcgttgaatgagtggaaccgcttattcttggtcccc
ggcgccgcgcactgcgcctccagtaccgatcaacccaatggccccttcccccaggcaact
ctcaagacgctcatcgaatgggtcgaaaatagtattgttccagaaactttgaatggtacg
gtgctggacggtgatcacaagggtgaacagcagcagatctgcgcttggcccttgcgtccc
ttatggacagagaacggcaccgttatgaactgtgtgtacgaccaggcttccttggacacc
tgggactatgaatttgatgcctatcgcattcctctatactaa

DBGET integrated database retrieval system