KEGG   Aspergillus oryzae: AOR_1_836014Help
Entry
AOR_1_836014      CDS       T01018                                 

Gene name
AO090026000452
Definition
[Pyruvate dehydrogenase [lipoamide]] kinase
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
aor  Aspergillus oryzae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 439 aa AA seqDB search
MWKPSERLMETIRHYASFPATGVSLRQMVQFGDRPSTGTLFRASQFLSEELPIRLAHRVQ
DLGELPDGLSEMPSIKKVQDWYAQSFEEIITLPRPTLTQEVKSRLLRPGRINGGASKILS
ETTQNPSIKEGQYRSSPTSALNHNGNGKAAATAARRYFVPSDDQGNWPPELNDYNERFAK
TLQHIKRRHDSVVTTVAQGILEWKRKRQRLQIDSTVQSFLDRFYMSRIGIRMLIGQHIAL
TEQTHVRHPNYVGIICTKTNVREVALEAIDNARFVCEDYYGLFEAPKVQLVCKDDLNFMY
VPGHLSHMLFETLKNSLRAVVETHGADKEAFPVTKVIIAEGKEDITIKVSDEGGGIPRSS
IPLVWTYMYTTVEQTPNLDPDFDKSDFKAPMAGFGYGLPISRLYARYFGGDLKLISMEGY
GTDVYLHLNRLSSSSEPLQ
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgtggaagccgtcggagaggctgatggagaccatcagacattatgccagcttccccgcc
actggtgtctcccttcggcagatggtccaatttggagacaggccttcgaccgggactctt
tttcgcgcctctcaattcctctccgaggaactcccaattcgactcgctcaccgtgtccag
gacctgggggaactccctgatggactcagcgaaatgccctctatcaaaaaggtccaggac
tggtatgcgcaatcgttcgaggaaatcatcaccctgcctcgaccgactcttacccaggaa
gtgaaatcccggctgttacggccaggaagaatcaacgggggtgcttcgaagatcctctcg
gaaaccactcagaaccctagtatcaaggaagggcaataccggtcctctcccacctcggca
ttgaatcataatggaaacggaaaggctgctgccaccgcggctcgaagatattttgtacct
tccgatgaccagggcaattggcctccggagttgaatgattataacgaacgcttcgcgaag
actctccagcatattaaacgacgacacgacagcgttgtaaccactgtggctcagggtatt
ctggaatggaagcgcaaacgccaaagattacagattgactcgaccgttcagtccttcctc
gatcgattttatatgtctcggataggtatacgtatgctaatcggccaacatatcgctttg
acagaacaaacgcacgtccgccatccaaattacgttggtattatctgtacgaagacaaat
gttcgtgaagtcgccctcgaagctattgataatgcccgattcgtgtgtgaagattactat
ggtctgttcgaagctccgaaggtccagcttgtctgcaaagatgacctgaacttcatgtac
gtcccgggccacttgtctcatatgctctttgaaaccctcaagaactcccttcgtgcagtg
gtagagacccatggtgcagacaaggaagctttcccagtcaccaaagtcatcattgccgaa
ggaaaagaagacatcactatcaaggtgtccgacgagggtggtggaattccccgttcttct
atccccttggtttggacgtacatgtacactacggtcgagcaaacacccaatttggatccc
gattttgacaaaagcgacttcaaagcccctatggccggcttcgggtatggattacctatc
agtcgtttgtatgctcggtacttcggtggggacttgaaattaatcagcatggaaggatat
ggtacggatgtttatcttcatttgaaccgactttcctcgagctcggagcccctgcaatga

DBGET integrated database retrieval system