KEGG   Aspergillus oryzae: AOR_1_850134Help
Entry
AOR_1_850134      CDS       T01018                                 

Gene name
AO090102000521
Definition
translation initiation factor eIF4E3
Orthology
K03259  
translation initiation factor 4E
Organism
aor  Aspergillus oryzae
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:aor00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AOR_1_850134 (AO090102000521)
Translation factors [BR:aor03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    AOR_1_850134 (AO090102000521)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 357 aa AA seqDB search
MDNANLWTRRSNSSKLSLSMTGTDGKDGARVELPRTKRFGPDSSHGRSNPFNALSPLSGG
VSSPSTNASSAFGLGSGAFASFGAPKTPGGSDLKTPLEKRDNPTEHDSAESAKTKAANTA
IKEHPLKSTWVIWYRPPTPKYSDYEKSTVPLASISSVESFWSIYSHLKRPSLLPTVSDYH
IFKKGIRPVWEDDANKKGGKWVVRLKKGVADRYWEDLLLAMVGDQFAEAGDEVCGAVLSV
RSGEDVLSVWTRIDGGRNIKIRETIKRLLGFPIDTNIVWKSHDDSIAQRSAIDQARQEKA
TGNNGHHHHHHHHHHHHHHNNNNNNNNNNQHHNLGADRRRVTANDDSTGDKGKDVAS
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggataacgcaaatctttggactcgccgctccaactcctctaagttgtctctgtctatg
acgggaacagacggcaaagacggtgccagagtcgaacttccccgcacgaagcgttttggt
cctgatagctcccatggtcgatcgaatcccttcaacgctctatctccgctctcgggcggt
gtgtcctccccgtcaacgaacgcttcctctgcattcggcctgggatccggcgcctttgca
tctttcggtgcccccaaaacccccggcggctccgaccttaagacgcccctcgagaaacga
gacaacccgacagaacacgactcggcggagagcgcgaagacgaaggccgctaataccgcc
atcaaagaacacccgctgaagtccacctgggtcatttggtaccgtccacccacccctaaa
tactccgattacgaaaagtcaaccgtcccccttgcatctatatcctcggtcgagagtttc
tggtcgatatattcgcacttgaagcggccttctcttctacccactgtttccgactatcat
atctttaagaagggtattcgccctgtttgggaagatgatgccaacaagaagggtgggaag
tgggtggtgagattgaagaagggtgtcgctgatcggtactgggaggatcttctcttagct
atggttggggaccagttcgcggaggctggtgatgaagtttgcggtgctgtcctcagtgta
cggagtggcgaagatgtgttgagtgtctggaccaggattgacggtgggcgcaatatcaag
atcagggagacgatcaagcgtctactaggcttccccatcgacaccaacattgtctggaag
agccatgacgacagcattgctcaacgctctgccattgaccaagctcgtcaggagaaggcc
accggaaacaacggtcatcaccatcatcatcaccaccaccaccaccaccatcaccacaac
aataacaacaacaacaacaacaacaaccaacatcacaatctaggtgcagatcgacgaaga
gttacggcgaatgatgactctacgggggataaaggaaaggatgtggcgtcgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system