KEGG   Aspergillus oryzae: AOR_1_862134Help
Entry
AOR_1_862134      CDS       T01018                                 

Gene name
AO090102000527
Definition
ubiquitin hydrolase
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
aor  Aspergillus oryzae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 1123 aa AA seqDB search
MDNVPDNEMLVDEYEQYHNDRTDDVVVSRSGSEEPEPEPLANDYAAMMARILPKDPELET
EDEAYHTWHIKDWRKLKKKEHGPTFHCAGFPWRILFFPYGNHVEHASFYLEHAWDNEPPE
NWYACVQFGLVLWNVNDPSIKISHVATHRFNADEGDWGFTRFCELRRLFNLAWEGRGVPP
VQNDEAMVTAYVRVVKDPTGVLWHSFQNYDSKKETGMVGLKNQGATCYLNSLLQSLYFTN
AFRKATYQIPTEAEASRDNSAWTLQRLFYNLQTSENPVSTAELTASFGWESRQIFEQQDV
QELSRKLMERLEEKMKGTPAEKALPELFVGKTKTYISCINVDYESSRVEDFWDIQLNVRN
NKTLDDSFKDYIQVETLEGENKYDAGPPYGLQDAKKGVIFESFPPVLHLHLKRFEYDINR
DAMMKINDRHAFPMEFDATPYLSNDADKSEPWVYQLHGVLVHSGDLNAGHYYAFLKPTKD
GYWYRFDDDRVTRATDKEVLEENYGGEYELANGAAGVKQPYTRGLSTKRSMNAYMLVYIR
KSRLDDVLLPIMKEDIPSHIETRLIEERVELARRKKEREEAHLYINVGVLNEESFKSHHG
FDLTSLDLPAGDPALPKQYRILKALKVGEFAEQLAQEKGIDANRVRFWVMVNRQNKTTRP
DQVIKDPDMSVEEAYSRFGTKGNPFRVWMEVGQPSADGTVSWPDNNNSVLVFLKHFDAPS
QTLSGVGPVYVRKNQKVAELAPTILEKMEWPAGTEFMLYEEIKHNMIDVMKPKQTFQQSE
IQDGDIITFQKSIKEADLPSTALYQDARQYYDYLLNRISVTFAPIKAGEGDEFTLTLSRK
MTYDQFSKKVGEHLNVESTHLRFAPVMASTGKPKQFIKRNPNQANQTLYQILSGTMTGYG
YSMHRSDALYYEVLETSLSDYESKTSLKVTWLPEGITKEQVVEVLVPRDGTISDLLSGLQ
KKANLDEDTIREVRIYETHAGKIYRDFPVDTKIAGINEFVTLYAERMPEEEVNMGEGERT
INAYNFDRDLNRPHGVPFKFVLKPGEVFKETKERLSKRTGIKGKQFEKIKFAAVPRSLYS
SPRYLEDDDILSDIVGDSDDLLGLDHVNKNRSFWNRSESFFIR
NT seq 3372 nt NT seq  +upstreamnt  +downstreamnt
atggataacgtcccagataatgaaatgctcgtcgacgaatatgagcagtatcacaatgac
aggacggatgatgttgttgtctctcgatccggatcggaggagccggagccggagcctctt
gcaaacgattatgcagcgatgatggcacgaatccttcctaaagacccagaacttgaaacc
gaagacgaggcgtatcacacatggcatattaaagactggcgcaagttgaagaagaaggaa
catggaccgacattccactgcgcaggattcccatggcggattctcttcttcccatatggt
aaccacgtggagcacgcatcattttacttggaacatgcttgggacaacgagccacctgaa
aattggtacgcttgtgtgcagttcggcctcgtcctgtggaacgtaaacgatccatccatc
aaaatctctcatgttgctactcatcggttcaatgcggatgagggagactgggggtttacc
cgattttgtgaactacgaaggctgttcaacttagcatgggaaggccgtggagtgcctcct
gtacaaaacgatgaagctatggttacagcctatgtccgtgtcgtcaaggatccaacgggt
gtcttgtggcacagcttccaaaactatgactcgaagaaagaaactggcatggttggatta
aaaaaccagggtgccacctgctacctcaactcacttctacagtcgctatacttcactaat
gcgttccgaaaggccacatatcaaattccgaccgaagcggaagcctcacgggataacagt
gcttggacattgcagaggttgttctataatctccaaacgagtgaaaaccctgtttcaaca
gctgagcttactgcatcttttggctgggagtcgagacagatttttgaacaacaggatgtt
caggaactgtcgcgcaagctgatggagagactcgaggagaaaatgaagggcactccagcg
gagaaggcattgccggagttatttgtcggaaagacgaagacttacatatcctgcatcaat
gtcgactatgaatcctcgcgtgtggaagacttctgggatattcaactcaatgtaaggaac
aacaagactttggacgacagcttcaaggattatattcaagtggaaacgctcgaaggtgag
aacaagtacgacgctgggccaccgtacggtttgcaagacgccaagaagggtgttatcttt
gaaagtttccccccggtcctacatcttcacttgaaacgattcgaatatgacatcaaccgc
gacgctatgatgaaaattaacgatcgacatgcattccctatggaatttgatgccacgcct
tacctctccaatgatgctgataagtcagagccgtgggtctaccagttacatggcgtgctg
gtacacagtggcgatctgaacgcaggccattattacgctttcttaaaacctaccaaagac
ggatactggtatcggttcgacgacgatagggttacccgagctactgacaaggaagtcctt
gaagagaattatggtggtgaatatgagctggccaacggcgcggccggcgtcaagcaacct
tacacacgtggtctatcaacgaagcgctccatgaacgcttacatgttagtttacattcgg
aagtcaaggttggacgatgtccttcttcccataatgaaagaagacatcccatctcacatt
gagacgcgtctgatcgaagagcgcgtggagctggcacgcaggaagaaggagagagaggaa
gcccacttgtacatcaatgtcggagtcctgaatgaggagtctttcaagtctcaccacgga
tttgatctgacgagccttgacctacctgctggagacccagcactcccgaagcaataccgg
atacttaaagctttaaaggttggcgagtttgctgagcaacttgcacaagaaaagggtatt
gatgccaaccgagtccgattctgggttatggtaaatcgccagaacaagacaactcgacca
gatcaggttatcaaggatccagatatgtcagtggaagaggcctacagcagattcggcact
aaagggaatccgttcagagtgtggatggaggttggacagccctccgcggatggaacagtt
tcttggccagacaacaacaactcggtgctagtcttcctgaaacactttgatgccccgtcg
cagacactgtcgggtgttggccccgtatacgttcgcaaaaatcaaaaggtagctgagctt
gccccaacaatcctcgagaagatggaatggcctgccggtacagagttcatgctgtatgag
gaaatcaaacataatatgatcgatgtcatgaagccgaagcagaccttccaacaatctgag
atccaagatggcgatatcattacgtttcagaaatcgatcaaggaagcggacctaccttct
actgccctctatcaggatgcgagacagtactatgactaccttttaaaccggattagcgtt
actttcgctccgataaaggctggagaaggcgatgagtttaccttgactctgagtcgtaag
atgacttatgaccagttctccaagaaagttggtgaacatttgaatgtcgagtctacgcac
ttgcgcttcgctcctgtcatggcaagcacggggaaacccaagcaatttatcaaacgcaac
cccaaccaagcgaaccagacgctgtatcaaattctcagtggaacgatgaccggttacgga
tatagcatgcaccgttccgatgcactgtattatgaggttctggagacaagtctgagcgac
tacgagtctaaaacttccctaaaggtgacctggcttcccgagggtattacgaaagagcaa
gttgtggaagtcttggtaccccgcgatggcaccatttcagatcttctaagcgggttgcaa
aagaaggcaaaccttgacgaagatacaatccgtgaagttaggatctatgagacgcatgcc
ggcaagatctacagagactttccggtggatactaaaattgccggtatcaatgagtttgtg
acactttatgccgagagaatgcccgaggaagaggttaatatgggagagggcgagcgcaca
attaacgcctataactttgatcgtgatttgaacaggccacatggtgtgccgttcaagttc
gttcttaaaccgggtgaggtcttcaaagaaacaaaggagagactctctaagcggactggc
atcaagggtaaacaatttgaaaagatcaagtttgccgcggttcctcgttctctatactcg
agtccacgatatctcgaagacgatgatatcctttccgacattgtcggcgattccgacgac
ctccttggtctcgaccatgtaaataagaaccgcagcttttggaacagaagtgaatcgttt
ttcatccgatag

DBGET integrated database retrieval system