KEGG   Aspergillus oryzae: AOR_1_866144Help
Entry
AOR_1_866144      CDS       T01018                                 

Gene name
AO090023000503
Definition
possible replication factor-a protein
Orthology
K10739  
replication factor A2
Organism
aor  Aspergillus oryzae
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:aor00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    AOR_1_866144 (AO090023000503)
   03420 Nucleotide excision repair
    AOR_1_866144 (AO090023000503)
   03430 Mismatch repair
    AOR_1_866144 (AO090023000503)
   03440 Homologous recombination
    AOR_1_866144 (AO090023000503)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 276 aa AA seqDB search
MDNYGYGSSSYGGGGGFVPGETNSPAAGKSADGNNTTLRPITIKQALDATQPYPEADYQI
DGADVGSICFVGQVRNISTQSTNITYRIDDGTGEIEVKQWVDSATADTMDTDDSKAGAGK
NQVVNNGYAKIFGKLKTFGNKRFVGSHCVRPLTDINELHCHMLEAVAVHLFFTRGPVGGS
GGAGAAAGGAGGADATMGGVDDYSAGRNLPAMSPVARRVYNLLKTEPQSNEGLHAQLIAA
KLSLPMPDVARAGDELLTAGVIFSTVDEQTWAILDY
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atggataattatggctacggttcttcctcctatggaggcggtggtggcttcgtgccagga
gagacgaacagccccgccgctggaaagagcgcagacggcaataataccacactccgcccc
atcacaatcaagcaggccctcgacgcaacacaaccctatcccgaagccgattaccagatt
gacggcgccgacgtaggcagcatttgcttcgtcggacaagttcgcaacatcagcacccaa
agtacaaacatcacatacagaatcgacgacggcacgggcgaaatcgaagtgaaacaatgg
gttgactctgccacggcagacaccatggacacagatgacagcaaggcaggcgcaggaaag
aatcaggtcgtgaacaacggatatgccaagatattcgggaaattaaagacgttcggaaat
aagcgctttgtaggatcacattgcgtgcggcccttgacagatatcaatgagctccattgc
cacatgctcgaggctgttgctgtgcatcttttctttacccgtggtcctgttggtggctcc
ggtggcgctggtgccgctgctggtggagcaggcggtgctgatgccactatgggtggtgtt
gatgattacagtgctggcagaaaccttcctgccatgagccccgtggcaaggagggtgtac
aatttgttgaagacagaacctcagagcaatgagggtctacatgctcagctcattgcggct
aagctgagtttgcccatgccggatgtcgcccgcgctggtgatgagctgcttacggctggt
gtgattttctcgactgttgatgagcagacctgggctatattggattattag

DBGET integrated database retrieval system