KEGG   Aspergillus oryzae: AOR_1_868114Help
Entry
AOR_1_868114      CDS       T01018                                 

Gene name
AO090701000473
Definition
lysophospholipase 1
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
aor  Aspergillus oryzae
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    AOR_1_868114 (AO090701000473)
Enzymes [BR:aor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     AOR_1_868114 (AO090701000473)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 627 aa AA seqDB search
MKVALLTLAAGLANAASIAVTPRAFPNAPDKYAPANVSCPSTRPSIRSAAALSTSEKDWL
QVRRNETLEPMKDLLGRLNLSSFDASGYIDRHKNNASNIPNVAIAVSGGGYRALTNGAGA
IKAFDSRTSNSTARGQLGGLLQSSTYLSGLSGGGWLVGSVYINNFTTIGDLQASDKVWDF
KNSILEGPDVKHFQLINTAAYWKDLYDAVKDKRNAGFNTSLTDYWGRALSYQFINATTDD
GGPSYTWSSIALGDDFKKGKMPMPILVADGRNPGEILIGSNSTVYEFNPWEFGSFDPSVY
GFAPLEYLGSNFENGELPKGESCVRGFDNAGFVMGTSSSLFNQFILRLNGTDIPNFLKEA
IADVLEHLGENDEDIAVYAPNPFYKYRNSTAAYSSTPELDVVDGGEDGQNVPLHPLIQPT
RNVDVIFAVDSSADTDHSWPNGSSLIYTYERSLNTTGIANGTSFPAVPDVNTFLNLGLNK
RPTFFGCNSSNTSTPTPLIVYLPNAPYTAESNTSTFQLAYKDQQRDDIILNGYNVVTQGN
ASADANWPSCVGCAILQRSTERTNTKLPDICNTCFKNYCWDGKTNSTTPAPYEPELLMEA
STSGASKDQLNRTAAVIAFAVMFFMTI
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcgccctgctcaccttagcagcgggcttggccaatgccgcctcgatcgccgtc
actccacgggcgttccccaatgcccctgataaatatgctcccgcaaatgtttcctgtccg
tcgactcgtcccagtatccgcagtgccgccgccctgtccaccagtgagaaggattggttg
caagtgcgtcggaatgagacccttgaacccatgaaggatttgctcgggcggctcaatcta
agctcctttgatgcctcggggtacattgaccgtcataaaaacaatgcatcgaatattcca
aacgtggccattgccgtttcaggtggtggttaccgcgctttgaccaatggcgcgggtgct
atcaaggcattcgatagtcgtacctccaactccacagcccgtggacagctcggaggcctt
ctgcagtcctctacttatctatcgggcctcagtggtggtggatggctcgtgggctccgtg
tacatcaacaacttcaccactatcggtgacctgcaggccagcgacaaggtctgggacttc
aagaactctattctggagggtcctgatgttaaacatttccaactgatcaacactgccgcg
tactggaaggatctgtacgatgcggtgaaggataagagaaacgccgggttcaacacttcg
ttgaccgactactggggccgtgctctctcctatcagttcatcaacgctaccactgatgat
ggcggtcccagttatacctggtcgtcgattgccttgggcgacgatttcaagaagggcaag
atgcccatgcctatcctcgtcgccgatggacgtaacccgggcgaaatacttattggaagt
aactcgactgtgtatgaatttaacccatgggagttcggctccttcgacccgtcagtatac
ggctttgcaccattggagtatcttggatccaatttcgagaacggtgaactccccaagggg
gaatcgtgcgtgcgcggctttgacaatgcgggttttgtcatgggtaccagctcttccctg
tttaaccagttcattctgcgtctgaacggcaccgatatccctaatttcctcaaggaggcg
attgccgacgtcttggaacatctgggcgaaaacgatgaggacattgcagtttacgcaccc
aaccccttctacaaatatcgcaattcaacggcagcatattcgtcaaccccagagctggac
gtggtcgacggaggtgaagatggacagaacgtgcctctacacccgttgatccagcccacc
cgcaacgtggatgtgatctttgccgtggattcgtccgctgatacggaccatagctggccc
aacggatcctccttgatctacacctatgaacgtagcttgaatactacaggtatcgccaac
gggacctccttccctgcggtgcccgacgtcaacacgttcctcaaccttggcctgaacaaa
cgcccgaccttcttcggatgcaattcatccaacaccagcaccccgaccccattgattgtc
tacttgcccaacgccccttacaccgccgagtccaacacgtcaaccttccagctggcgtat
aaggaccaacaacgcgatgatattatcttgaacggctacaacgtcgtcacccagggcaat
gccagtgccgatgcaaactggccctcgtgcgttgggtgcgctattctccagcggtccacc
gaacgtacgaacactaagcttcccgatatctgcaatacctgcttcaagaattactgctgg
gacggaaagaccaacagcaccacaccggccccctatgaaccggagctattgatggaggcg
tcgacttccggggcctcgaaggatcaactgaaccggacagctgcagtcatcgcgttcgca
gttatgttctttatgacgatctag

DBGET integrated database retrieval system