KEGG   Aspergillus oryzae: AOR_1_876164Help
Entry
AOR_1_876164      CDS       T01018                                 

Gene name
AO090001000500
Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
aor  Aspergillus oryzae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AOR_1_876164 (AO090001000500)
Enzymes [BR:aor01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     AOR_1_876164 (AO090001000500)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 597 aa AA seqDB search
MRLPCVPSCALRGVRTPLAFARIGQRYSSTYDAAVIGGGITGLTAAYRLSQDPNCSKITL
YEKAPRVGGWLLSEKIPVEGGNVVFEYGPRTLRTAVPSCLPLLDLLVELGLHDDVLLTSS
SSPAARNRYIYYPDHLVRMPAPDPNAGPIENITNPLFAMLREPVFEGLIASALLEPVRAP
PDHKTFNSDESVADFVSRRLCPEVADNLVSALFHGIYAGDISRLSAQTLLGTFRDLENDD
RRVIGGYINSLMSDVKLMAMDDLLALESVAHEKPGMYWKSLRTLVNKTSVLTLKDGLSQL
SDALVDALKKSKKVDVLANTDVKSITQNPMTDDLIVGSGQDRSRIHNRVIATIPAPELAN
KLATTTVKDQKVPQSTIRNLQEHNYAVTVMVVNLYFPNPDLLPVSGFGYLIPRSIPYEQN
PERALGVIFGSDSSVGQDTAPGTKLTVMMGGHWWDGWKESDYPDHDTAVAMSRALLHRHL
GITDAPTLTSSRLQRNAIPQYTVGHLSRMRELSRSTRHELNNRLTLAGSWYNGVGVTDCI
RQGYLAASFGVGARKLGPGDGDRPWRRFDYEKWELEGGIVTSPVRWAEVYRTERKHF
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgagactaccatgtgtccctagctgtgcactaaggggggtgcgcacgccattggcgttc
gcccgcatcggccagagatactcctcaacgtacgatgccgccgtcattggcggtggcatc
accggtctcacagcagcgtatcggctatcgcaggaccccaattgctccaagatcacacta
tacgagaaggctcctcgtgtagggggctggctactgtcagaaaagattccggtcgaaggt
ggaaacgtcgtttttgagtatggcccgcggaccttgcggaccgcagtcccctcgtgccta
ccccttctcgatctgctcgtcgagttaggtctacatgatgacgttctcttaaccagcagc
tcatcgcctgctgcgcgcaatcgttatatctactatcccgaccatctcgtccgtatgccc
gcacccgaccccaatgccggaccgatagaaaatattacaaatccgctatttgctatgtta
cgtgagccggtcttcgagggcctaattgcgagtgctctcttggagccagtccgcgctcct
ccggaccacaaaacatttaactccgacgaatccgttgcggacttcgtgtcgcgccgattg
tgcccggaggtagcagacaacctcgtttcagctttgttccatggtatctatgcgggcgac
ataagtcggttaagcgcgcagacactgctgggtaccttccgggaccttgaaaatgatgac
cgccgagttatcggaggctacattaattctctgatgtcggatgtcaagcttatggccatg
gatgacctgttggccttggaatctgtcgcacatgagaaacctgggatgtactggaaaagc
ttacggacgctcgtcaacaagactagcgttttgacgttgaaagacggtctgagccagctc
tcggacgccctggtcgacgctttgaagaaatccaagaaggttgacgtgttggcaaatacg
gacgttaagtccattactcagaacccgatgactgacgatcttattgttggatctggacag
gacaggtctcgaatccacaaccgcgtgattgctacaattccagctcccgaactggcaaac
aagctcgcgactacgacagtcaaagaccagaaagtacctcaaagtactattcggaacctt
caagagcacaattatgctgtaacagtcatggttgtcaacttgtatttccctaacccagac
ctcctcccggtcagcggctttggatatctcataccgcgatcgatcccttatgagcagaat
cccgagagggcattaggggttatatttggatctgattctagcgtgggtcaagatactgca
cccggcactaagcttacagtgatgatgggtggccattggtgggatgggtggaaagagtcc
gattatcccgaccatgacacagctgttgcaatgtctcgtgcgttgcttcaccggcatctg
ggcattacggatgcgcccactctaacgagcagccggctgcagcggaatgccattcctcaa
tacactgtgggacacttgtctcgcatgcgcgaactgtctcggtccacacggcacgagctt
aacaatagacttactctggcaggaagttggtataatggtgttggtgtgacggactgtatc
cgacaggggtatttagcggcgtcgttcggcgtcggtgctcgaaagctgggccccggtgac
ggcgatcgcccctggaggaggttcgactatgaaaaatgggagttggagggcggcatcgtc
acatctcctgtacgatgggctgaggtgtacaggaccgagcgcaaacatttttga

DBGET integrated database retrieval system