KEGG   Aspergillus oryzae: AOR_1_894144Help
Entry
AOR_1_894144      CDS       T01018                                 

Gene name
AO090023000520
Definition
NADPH--cytochrome P450 reductase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
aor  Aspergillus oryzae
Brite
Enzymes [BR:aor01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     AOR_1_894144 (AO090023000520)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 695 aa AA seqDB search
MAQLDTLDLVVLVALLVGSVAYFTKGTYWAVAKDPYASSGPAMNGAAKAGKTRDILEKME
ETGKNCVIFYGSQTGTAEDYASRLAKEGSQRFGLKTMVADLEDYDYENLDKFPEDKVAFF
VLATYGEGEPTDNAVEFYQFITGEDVAFESGASAEEKPLSALKYVTFGLGNNTYEHYNAM
VRNLDAALQKLGAQRIGSAGEGDDGAGTMEEDFLAWKEPMWTALSEAMGLQEREAVYEPV
FNVTEDESKSAEDETVYLGEPTKGHLEGQPKGPFSAHNPFIAPIVESRELFTVKDRNCLH
MEISIAGSNLTYQTGDHIAVWPTNAGAEVDRFLQVFGLEEKRHSVINIKGIDVTAKVPIP
TPTTYDAAVRYYMEVCAPVSRQFVSSLAAFAPDEATKTEIQRLGSDKDYFHEKITNQCFN
IAQALQSITSKPFSAVPFSLLIEGLNKLQPRYYSISSSSLVQKDKISITAVVESVRLPGA
SHLVKGVTTNYLLALKQKQNGEPSPDPHGLTYAITGPRNKYDGIHVPVHVRHSNFKLPSD
PSRPIIMVGPGTGVAPFRGFIQERAALAAKGEKVGTTVLFFGCRNRNEDFLYQDEFKAYE
EQLGDSLKIITAFSRETSQKVYVQHRLREQAELVSDLLKQKATFYVCGDAANMAREVNLV
LGQIIAQQRGLPAEKGEEMVKHMRSSGSYQEDVWS
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaactcgacactctcgatttggttgtcctggtggcgcttttggtgggtagcgtt
gcctacttcaccaaaggcacctactgggctgtcgccaaagatccttatgcctcttccggt
ccagcgatgaatggcgccgccaaggcaggaaagactagagatatcttggagaaaatggaa
gaaactggcaagaattgcgtcattttctacggttcccagactggaactgcagaggactac
gcctcgagattggccaaggaaggatctcagagattcggtctcaaaactatggttgctgat
ttggaagattacgactacgaaaacttggacaaattccccgaagacaaggtcgcctttttt
gttctcgcgacttatggcgagggcgagcctacggataatgctgtcgagttttaccagttc
atcaccggtgaagatgttgcttttgaaagtggcgcgtccgctgaagagaagccgctgtcc
gctctcaagtatgtcaccttcggcctcggtaacaatacctatgagcactacaacgccatg
gttcgcaatctcgacgccgctctgcaaaagcttggtgctcaacgtattggatctgctggt
gaaggtgatgacggcgctggcacgatggaagaagacttcttggcttggaaggaacctatg
tggaccgcgctttccgaggcgatgggtctccaggagcgcgaggccgtttatgagccggtg
ttcaatgtcacagaagatgagtctaagagcgccgaagacgagacggtctatctcggcgag
ccaactaagggtcatctcgaaggtcaacccaagggcccattctcggcccacaacccgttc
attgcgcctattgtcgagtctcgtgagctattcactgtaaaggatcgtaactgtctgcac
atggaaattagcatcgccggaagcaacctcacctatcaaaccggtgaccacattgctgtt
tggccgacaaatgctggtgctgaggtagatcggttcctgcaggtttttggacttgaggag
aagcgccattcagttattaacatcaagggcattgatgtgactgctaaggttccgatcccg
acccctaccacctatgatgccgctgttcgttactacatggaagtctgtgcccctgtttcc
cggcagtttgtctcgagtctggctgcttttgctcccgatgaggcgaccaagacagaaatt
cagcgtttgggcagcgacaaggattacttccacgagaagatcaccaaccaatgcttcaat
attgcccaggctctccaaagcatcacgtccaagcctttctctgccgttccgttctcattg
ctcatcgaaggcctcaataagctccagcctcgttattattccatctcgtcatcttccctc
gtccagaaggataagatcagtatcaccgccgttgtggaatccgtccgtttgcctggtgcc
tcccaccttgtcaagggtgtgaccacgaattacctccttgcgctcaagcaaaagcagaat
ggtgaaccttctcctgaccctcacggcttgacgtacgctatcactggtccgcgcaacaag
tatgatggcattcacgttcctgttcacgtccgccactcgaatttcaaactgccatccgat
ccctcgagacccattatcatggttggacctggtaccggtgtcgcacctttccgtggcttc
atccaagaacgagccgccttggcggctaaaggcgagaaagtcggcacaactgttttgttc
tttgggtgccgtaatcgcaatgaggatttcttgtatcaggacgaattcaaggcttatgag
gagcaacttggtgattcattgaagatcatcactgcattttcccgcgagacttctcaaaag
gtttatgtccaacatcggttgcgcgaacaagctgagctggtcagcgaccttctgaagcag
aaagccacattctacgtttgtggagatgccgccaacatggcgcgtgaggtcaatctggtg
cttggccagattattgcccaacagcgtggtcttcccgccgagaagggcgaggagatggtc
aagcatatgcgcagcagtggaagctaccaggaggatgtctggtcatga

DBGET integrated database retrieval system