KEGG   Aspergillus oryzae: AOR_1_898164Help
Entry
AOR_1_898164      CDS       T01018                                 

Gene name
AO090001000509
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
aor  Aspergillus oryzae
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    AOR_1_898164 (AO090001000509)
Enzymes [BR:aor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     AOR_1_898164 (AO090001000509)
Exosome [BR:aor04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AOR_1_898164 (AO090001000509)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 591 aa AA seqDB search
MQPSEIFVGSIDQGTTSTRFLIFNREGEPVASHQVEFPQIYPKSGWHEHNPLDLVSSVET
CVEQAVKQFESTGYSRNDIKAVGITNQRETTVVWDYETGEPLCNAIVWTDTRSQAIVKDL
KEKPGASRLQQICGLPLSTYSSSSKLLWMLTNVPRVKDAYERGTLAFGTVDTWLVYRLNG
GHQANVFVSDPTNASRTMFMNLETLEYDNSLLDFFDIRGRVHLPKIVPSSDTKAYGAISD
GILAGVPIMGCLGDQSSALVGQKGFSPGMAKNTYGTGCFLLYNVGEKPVISKHGLLATVA
YHFDGKPVYALEGSIAVGGSGVKFLQNNLEFFKESKEVNDLALTVEDNGGCVFVTAFSGL
FAPYWIDDAKGTIFGITQYTKKGHIARATLEATCFQTKAILDAMEKDSGHALSELAVDGG
MSNSDLAMQTQADLISIPVYRPKMRETTALGAAIAAGLAVGLWRNFAELRDINRAGGAVF
EPRISRQQSAESFALWEKAVNMSRGWVGNEVPPTVPETKKDVSVAVQHSDNTQIVPAKAN
GSILPAKRPLLSISNDLDDADEDYLYLELRRVEILQKLKKLTKLKVALLSA
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgcagccatcagagatcttcgtgggttcgattgaccagggtacgaccagtaccaggttt
ctgatcttcaatcgcgaaggggaaccggtggcctcgcatcaagtcgaattcccacagatc
tatccaaaatcagggtggcatgagcataacccacttgaccttgtgtcttccgttgaaaca
tgcgttgaacaagcagttaaacagtttgaatccactggatattctcgcaatgatatcaaa
gctgttgggattaccaaccagagagaaactaccgtcgtttgggattatgaaactggcgag
ccattgtgcaatgccatcgtatggacggacactcgatcacaagcgattgtcaaagacttg
aaggagaaaccaggggcttcacgattacagcaaatctgtggcctcccattgtcaacctat
tcatcctcgtctaagctgctatggatgctcacgaacgtccccagggtcaaggatgcttat
gagcgaggtacactagcttttggtacagtcgacacatggctcgtgtatcgtttgaacggt
ggccaccaagcaaatgtgtttgtttcggaccctaccaatgcgtcacggactatgttcatg
aacctagaaactctagagtacgacaactcgctcttggacttctttgatattcgaggaaga
gttcatctaccaaagattgttccatcctccgataccaaagcctatggagctatctcagat
ggaatcctcgctggcgtccctatcatgggttgtcttggcgatcaatcctcggcacttgta
ggtcaaaaagggttctcaccaggaatggcaaagaacacatacggcacagggtgtttcctc
ctttacaatgttggcgaaaagcctgttatttccaaacacggattattggccacagtagcc
tatcattttgatggaaaaccagtgtacgctctggagggaagcatcgctgttggtggctcg
ggagtcaagttcctgcagaacaatctcgagttcttcaaggaatccaaagaagttaacgat
ttggccctcacggtggaggataacggaggatgcgtttttgttactgcgttcagtggtctc
tttgcaccttattggattgacgacgccaaaggaaccatcttcggaattacacagtacacg
aaaaaaggccacatcgccagggccacacttgaagcgacctgcttccaaacgaaggcaatt
ttggacgcgatggaaaaagacagcggccacgcgctgtctgagctggcagttgacggagga
atgagtaactctgatcttgcaatgcagacccaagcagacctgatctccattccggtctat
cgccctaagatgcgagagacgaccgcgttaggtgccgccattgctgccggtctggcggtt
gggctttggcgaaattttgccgaactgcgcgatatcaaccgtgctggtggtgcggtcttt
gaacctaggattagccgtcagcaaagtgccgagtcatttgctctctgggaaaaggcagta
aacatgagcaggggatgggttgggaacgaagtgccacccactgtcccggagaccaagaaa
gatgtttccgttgctgttcagcacagtgataatacccagatagtcccagcgaaggccaac
ggcagcattcttcccgcgaagaggccgttgcttagtatctccaatgatctggacgatgct
gatgaggactatctgtatctggaactccggagagtcgagattctgcagaaactgaagaag
ctcaccaagctcaaggtagcccttttgtcagcatga

DBGET integrated database retrieval system