KEGG   Aspergillus oryzae: AOR_1_920074Help
Entry
AOR_1_920074      CDS       T01018                                 

Gene name
AO090038000543
Definition
N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase
Orthology
K12743  
N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase [EC:6.3.2.26]
Organism
aor  Aspergillus oryzae
Pathway
Penicillin and cephalosporin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Penicillin biosynthesis, aminoadipate + cycteine + valine => penicillin
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    AOR_1_920074 (AO090038000543)
Enzymes [BR:aor01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.26  N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase
     AOR_1_920074 (AO090038000543)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 3774 aa AA seqDB search
MTQLQPLSVADSGSISLSRATDSRANGGASVDNDMVNLNNGDINPHNGNGMGSSIRIHFP
GGIEGWKDSVNQIIERCDVSGLATDPTRYQLASTGFGDASTVYRQRFMAVPSEVYSALQE
LCVERRVSVRSVILFAMHQMLKGFGNGSKTITASLHVEENPQDSRPLWAVSPIFVSHESR
DEYSVAQAIESIESMCSSKKLSTHTIDKASSLVKLGLFDLLVVFADADDAHLPSFDFPLA
VMVEEGEAGLQLTLRFSDCLFDEETICNFTDALNILLAKAATGGATLISDIELLSFEQQQ
QLDEWNNTDGEYPASKRLHHLIEEEAERHEDKVAVVCEERKITYGELNTQANRLARYLHS
TGIQAEQIVALFLDKSEMLIVTILGVWKSGAAYVPIDPTYPDERVRFVLDDTEAQVIIAS
SRHAERLERQIIGDRKLCIIHLEPLLTFLAQDTSKFPAHNLDDLPLTSRQLAYVTYTSGT
TGFPKGIFKQHTNVVNSITDLSARYGVTGQHHEAILLFSAYVFEPFVRQMLMALVNGHLL
AIINDADKYDADKILPFIRAHNITYLNGTASVLQEYDFSYCPSLKRMILVGENLTEARYL
ALRKRFKNRILNEYGFTESAFVTALKIFDSDSTRKDTSLGRPVRNVKCYILNPALKRVPI
GATGELHIGGLGISKGYLNRPDLTPTRFIPNPFQTKREKKLGVNGLMYKTGDLARWLPTG
EVEYLGRADFQIKLRGIRIEPGEIEATLAQYPGVRTSLVVSKKLLKNTVETTNEHLVGYY
VCDNASVSETHLLSFLEKKLPRYMIPTRLVQLSQIPVNVNGKADLRALPAVDISKSSEVR
SDLRGDMEFALGEIWVDVLEARHGSISRNDNFFRLGGHSITCIQLIARIRERLSVSISVE
DVFATRTLERMAYLLQSKQQEASDGRYESESAAQSGPLERDAATEEVYMANSLQQGFVYH
YLKNMAQSDAYIMQSALRYNTTLSPDLFQRAWKHTQQVYPALRLRFKWGKEVLQVIDQDQ
VLDWRFLCFANVPTGAVEDQKLVELQRQDREEPYKLDTGRLFRIYLIQHSENRFTCLFSC
HHAILDGWSLPLLFEMVHDTYLQLLHGNNIAPPADDPYARTQRYLQTHREDHLDYWAGVV
EQIAERCDMNALLNERSRYKVQLADYDHIQDQRQLTVTLPGDAWLGELRQTCSAQGVTLH
SILQFVWHAVLHAYGGGTHTITGTTISGRNLPISGIERSVGLYINTLPLVIDHSAYKDKT
IMEAIEDVQAKVNAMNSRGNAELGHLRKTDLKHGLFDSLFVLENYPNLDKSRVLQHQSQL
QYSIQGGTEKLDYPLAVIAREVEATGGVTLSICYASELFEEVAISELLHMIHDTLVRVAQ
GLNDPVRSLEYLSSAQLEHLAAWNATEAKFPDTTLHEMFEVEANRKPEKTAVIYEERALT
YRELNERANRMAHQLRSDLSPKPNDVIALIMDKSEHMFVSILAVWKSGGAYVPIDPGYPD
DRIQYILEDTQAIAVIADSGYVTRIKEMAAPGTLLYPSDLTSTPDPKYSASNPSPLSQST
DLAYIIYTSGTTGRPKGVALEHHGVVNLQVSLSKIFGLRSTDDEVILSFSNYVFDHFVEQ
MTDAILNGQTLLVLNDEMRGDKERLYQYIEKNRVTYLSGTPSVVSMYEFSRFKDHLRRVD
CVGEAFSEPVFDKIRETFHGLVINGYGPTEVSITTHKRLYPFPERRTDKSIGQQVHNSTS
YVLNEDMKRVPIGAVGELYLGGQGVARGYHNRPDVTAERFIPNPFQTEEEMKTGRNSRLY
KTGDLVRWIPGSNGEIEYLGRNDFQVKIRGLRIELGEIEAILSSYPDIKQSVVIAKDRKE
GGQKFLVGYYVADATLSSAAIRRFMQSRLPGYMVPSRLIPISKLPVSPSGKLDTKALPFV
EEESEIDVVAPRNEVERTLCHIWAELLEIHPEEIGIYNDFFSLGGDSLKSTKLSFMVHET
FSRAVSVSTLFRHRTIEALAQLIINNSVDVNEITPLEYNEGQMIPVSGAQERLLFIHEFE
NGSNAYNIDISYKLPGSVDALNLEQALRGILSRHEALRTLLVKDDTTGSYIQKILSPDGA
QRMFSVKADVIKAMEQLDQERASLSQHIFRLGDELPWQARILRHESGSLYLIVTFHHTSF
DAWSLSVFERELQALYVALHKTKSAASLPTLRVQYKDYAQYHRRQLSRSHRSLSDFWLQK
LSGLESLQLITDRPRPGHFNYDGDDLSIELGQKETQNLREVAKECKSSLYVVLLSAYYVM
LASYANQTDIAVGIPISHRTHPQFQSIIGFFVNLVVLRVDVSHSAIGDLIRRVMKELVQA
QLHQDMPFQEVTKLLQVVNDASRHPLVQTVFNFEARPDEEHDSGSQDEGAIQFTQYRPVQ
PLDSVAKFDLNATVTELESGMRVNFNYATSLFNRSTIEGFLRTYEYLLHQLSELSAEGIK
EDTQLLLVPPREIGDAHLPLAQSPLATLAEERNAASLSQAFEYEASLAPGKIAIAQGDRV
LSFADLNKRANQLSRYMLSISSLGAEGRVALMLDKSIETIVCILAIWKTGAAYVPLDPTY
PTQRVRLILEETQAKTVLVNSHHVSKCEYMGAKVVSIDSPAVKTEVSQQLSSDLPAVAGL
DNLAYIIFTSGTSGKPKGVLVEQKGVLLLRDALRERYFGNDCTKQHSVLFLSNYVFDFSV
EQLVLSVLSGHKLIVPPADFVVDEEFYRMANTHGLSYLSGTPSLLQQIDLAQLHHLQSVT
AAGELLHATQYEKMRSSFGGTIYNAYGITETTVYNIITEFTVNSNFENAIRDVLPGTRAY
LLNKALQPVPFDAVGELYLAGDCVTRGYLNEPLLTDQRFLPNPFRNQEDFAAGRFSLLYK
TGDLFRCRFSHQQQPQLEYLGRDDLQVKMRGYRIELSEVQNILASSPGVQECAVVAKYDK
DDSYSRIAQSIVGYYTTDNEAVSEANILTSMKARLPTYMVPSHLCRLEGALPVTINGKLD
IKRLPEIGNASVVLSYSPPRNILEARVCKLWASVLGIERCGIDDDLFKLGGDSIMSLHLV
AQIHNQVGRKVTVRDIFEYRTIRALHDHVFMKDIDTSVVDQFRSEQGLVVGEAPLLPIQN
WFLSKPLQHPSYWNHTFYIRTPELDVTLLRAAIIELQQYHDAFRMRLRRKDNKIVQFFVK
DASPVQLRVLNMKDVDGPTAINETLSEWQSGFDLEKGPICAIGYLHGYEDRSARIWFSIH
HIAVDTVSWQILVRDLQMLYQNGSLGCKGSSIRQWSEAVQNYQPSKSEFGHWNDLIARTT
SSISALPASTGCRVRLTRNLSTEKTALLLQGSKGGQEVSVYDSLLAAVGLALQAICSRGP
SMVTIEGHGREEDVDHTLDVSRTMGWFTSMYPFEIPHLRTENLVEGVAAINERLRQVPAR
GIGYGALYGYTRHPLPQITVNYLGHLAPKKSKLDEWALAVGDNGLEYGLMTSPEDKDKSS
SAVDVTAVHIDATITIDMDSAWSLEDSEKFISNIEEGLNKIIDSVTSQETSSPADPQLTE
ETYTPYFEYLEPSRQGPTLFLLPPGEGGAESYFNNIVKHLPGTNMVAFNNYYLHSKRLRT
FEELAEMYLDHVRNIQPHGPYHFIGWSFGGILAMEMSRRLATSGEKIGLLGIIDTYFNVH
GATRSIGLGDAKILDPIHHIYHPDPTNFKGLPSATDHIVLFKAMKTNDQYESENQRHLYE
YYDGTPLNDMDKLLPSDTAIQLVPLTDDTHFSWARNPQQVHRMCAAIKDYLSGY
NT seq 11325 nt NT seq  +upstreamnt  +downstreamnt
atgactcagttgcagccactaagcgtagccgattcaggatcgataagcttatcgagggcc
acagactccagggccaatggaggtgcgagcgttgacaatgatatggttaaccttaacaat
ggcgacatcaaccctcacaatgggaatgggatgggaagcagtatccgcatccactttccc
gggggtatcgagggatggaaggattcagtgaaccagatcatcgagcgctgcgacgtgagt
ggtctagcaaccgaccccacgagatatcaacttgcatcgacgggattcggtgacgcgagc
accgtctaccggcagcgcttcatggcggttcctagcgaggtatactccgcattgcaagag
ttgtgtgttgaacgccgcgtcagcgtgagatccgtcattcttttcgccatgcaccagatg
ctgaaagggtttggtaatggatcaaaaaccattaccgcctctctgcacgtcgaggagaat
ccccaagattctcggccattgtgggcggtgtcacccatattcgtcagtcatgaaagcagg
gacgaatactccgtcgcacaagcgattgagagtattgaatcgatgtgcagttcgaaaaag
ctgtccacacacacaatcgacaaagcatcaagcctcgtgaaacttgggttgtttgactta
cttgtcgtcttcgccgatgcagacgatgctcatctcccatcatttgacttccccctggca
gtgatggtggaggagggtgaagcaggactccagctgactctgcgcttctccgactgtctt
ttcgatgaggagacaatatgtaatttcacagatgcccttaacatcttgctcgctaaagca
gcgacaggaggagcaacgctaatttccgatatcgaactgctgtcattcgagcaacagcag
cagctggatgaatggaataacacggatggcgagtacccagcatccaagcgactgcatcat
ctcattgaagaggaggcagaacgccacgaagacaaggtcgccgtggtttgcgaggagcga
aagatcacttacggcgagctcaacacccaggcaaaccgtctcgcacgctatcttcactct
acaggcatccaggccgagcagattgtcgcgttgttcctcgataagagcgaaatgctcatc
gttaccattctgggtgtgtggaaatctggcgcagcctacgtgcccattgaccctacgtat
ccagatgagcgggtccgattcgtgctggatgacacggaggcacaggtcatcatcgcgagc
agtcgacacgccgaaaggcttgaacgacagatcatcggcgacaggaaactctgcattatt
cacctggaaccattactcacattccttgctcaagatacctcgaaattcccagcgcacaac
ttggatgacctacctctcacgagcagacagcttgcctacgtgacatacacctctggaaca
acggggttccctaagggtatctttaaacaacatacgaacgttgtcaacagtatcaccgac
ctgtctgcccgttatggggtgactgggcaacaccacgaagcaattctgctcttctcggcc
tacgtattcgagccattcgttcgccaaatgctcatggcattagtaaatggccatctcctg
gccattatcaatgacgccgataagtatgacgccgacaaaatccttccattcattcgcgca
cacaacatcacctacctcaatggtactgcctctgttctacaagaatacgacttctcctac
tgtccgtccctgaagcgaatgattctggtgggtgagaatctaacagaagcccggtacctg
gccctgcgcaagcgattcaagaaccgcattcttaacgagtatggattcaccgagtcagcc
ttcgtaacagcgctcaagatttttgattccgactcgactcgcaaagacaccagtctagga
aggcctgtgcgcaacgtcaagtgctacatcctcaatcctgccctcaagcgtgtccccatt
ggggctacgggcgagctgcacattggaggattaggtatttcaaagggatacctcaaccgt
cccgatctcaccccgacgcggttcatccccaacccctttcagacgaagcgcgagaagaag
ctcggagttaacgggttaatgtacaagaccggcgacctggcccgctggcttccgaccggc
gaagttgaatatttgggacgcgcagattttcagatcaagttgcgaggcatccgaatcgag
cccggcgagattgaggcgacattggctcagtaccccggcgtccggactagtctggtggtg
tctaaaaaacttctgaaaaatactgtggagactacgaacgagcacctcgtgggttactat
gtctgcgacaacgcctcggtatccgagacgcacttgttgtctttcttggagaagaaactg
cctcgatacatgatcccgacgcgtctggtgcagctgtcgcagatcccagtgaacgtgaac
ggaaaggcggacctgcgcgccctgccagccgtcgatatatccaaatcctccgaggttcgt
tccgacctccgaggcgacatggagtttgccctgggggaaatctgggtcgacgtactggaa
gcccgccacggatcgatctctcgcaacgacaacttcttccgtcttggaggacacagcatc
acctgtattcaactcattgcacgcattcgagagcgactttcagtaagtatatctgtcgag
gatgttttcgcaacaagaacgctggagcgcatggcataccttctgcagagcaaacagcag
gaggcatcagatgggcgctatgagagcgagtctgctgcgcagtcagggccactggagaga
gatgcagcaaccgaggaggtatatatggcaaacagtcttcagcaggggtttgtctatcat
tatctaaagaacatggcacaatctgatgcctacataatgcaatccgccctgcgatataat
accacattatccccagatctgttccagagagcctggaagcacacacaacaggtctatcca
gcattgaggcttcgattcaagtggggaaaggaagtattacaagtgatcgatcaggatcaa
gtcttggattggcgtttcctctgcttcgccaacgtgcctacaggtgctgtcgaggatcag
aaattggtcgaattgcagcgccaggaccgcgaggagccatacaaactggataccggtagg
ctgttccgcatctatttgatacagcacagcgagaatcgcttcacatgtctctttagctgc
caccacgcaatcctcgatggttggagtctgccgcttctctttgagatggtccatgacact
tacctgcaactgctccatgggaacaatatcgccccacctgcagatgacccttacgctcgc
actcaacggtacctccaaacgcaccgtgaagatcatctggattattgggccggggtggtt
gagcagatcgccgagcggtgcgatatgaatgccttgttgaacgagcgtagtcgttacaaa
gtccaactggcggactatgaccacatacaggaccagagacagctgacagtgaccctcccc
ggagatgcatggctaggagaactccgtcagacctgctccgcccaaggcgttaccttacat
tcgatcctccagtttgtttggcacgccgtgcttcacgcttatggaggcggcacccatacc
atcaccggcacgaccatctctggaagaaacctgcccattagcggaattgaacgatccgtt
gggctttatatcaatacgctaccattggtaatcgatcattcagcatacaaggacaagact
atcatggaggccatcgaggatgtgcaggctaaggtgaacgcgatgaacagccgcggcaat
gcggaactgggccatctacgcaaaaccgacctgaagcacggattatttgactctttattc
gtgcttgaaaactacccaaacctggacaagtcgcgagttttacagcatcaaagccaactg
caatattcaatccaaggaggtactgagaagctggactatccgctggctgtcattgcacgt
gaagttgaggcgactggaggagtcactctgtccatctgctatgccagtgagctgtttgag
gaggtggccatttcagagctgcttcatatgatccatgacactctggtgcgggttgcgcaa
ggcttgaatgatcctgtccgcagcctagagtacctctcatctgcccaactggagcatctt
gctgcgtggaatgctacggaagcgaagtttcccgacaccacattgcatgagatgtttgag
gttgaagcgaatcggaagcccgagaaaacagcggtcatttatgaggagcgggccttaacc
tatcgcgaactgaatgagcgggcgaaccgtatggcacatcaactaagatccgacctcagc
ccgaagcccaatgatgtcatcgccctcataatggacaagagtgaacatatgttcgtcagc
attttggccgtgtggaagagtggaggtgcatatgttccaattgaccctggatatcccgac
gaccgcatccagtatatcctagaggacacccaggccatcgctgtcattgcggactccggc
tatgtaactcgcatcaaggaaatggctgcgccggggacgcttctttatccctctgacctg
acatccactccggatccaaagtacagtgcatcaaacccttctccgttaagtcaaagcaca
gacctggcttatatcatctatacatctggcacgacaggtcggcccaagggcgtcgcattg
gagcatcatggagtggtcaacctgcaggtgtcgctatccaaaatatttggcctccggagt
actgacgacgaggtaatactttctttttccaactatgtattcgaccattttgtggagcag
atgaccgacgccattctcaacggccaaacactactggtactcaatgatgaaatgcgcgga
gacaaagagagactatatcaatacattgagaagaaccgggtgacctacctgtctggcacc
ccatctgtggtttcaatgtacgagttcagccgtttcaaggaccatctccgccgtgtagac
tgcgtcggagaggcgttcagtgaaccggtcttcgacaagattcgcgaaactttccatggc
ctggtcatcaacggctacggtccaacagaggtctctatcaccacccacaaacgtctctac
ccgttcccagagcggcgcacggacaagagtatcggccagcaggtccataatagcacgagc
tatgtgctaaacgaggacatgaagcgcgttcccatcggggctgtcggcgagctctaccta
ggtggtcaaggtgtggcacgaggttatcacaatcgccccgatgtgaccgcagagcgattc
attcccaacccgtttcagacagaagaggaaatgaaaacaggccgtaattctcgtctctac
aagacgggtgatttggtacgctggatcccgggaagcaacggggagattgaatacctgggc
cgcaatgacttccaggtcaagattcgcggattgcgcatcgaactaggtgagatcgaggcc
atcctgtcatcataccctgatatcaaacagtctgtggtgattgcgaaggatcgcaaagaa
ggaggacagaaattcctcgttggctactacgtcgctgatgcaacgctgtcgtccgccgct
attcggcgctttatgcagtctcggctgcctggctacatggtaccctctcgtctcatacca
atcagcaaactccctgtctctcccagtggaaaattggacacaaaggccttgcccttcgtc
gaagaagagagcgagattgatgtggtggcgccgcgcaatgaagtggaacgcaccctttgc
cacatctgggcggaactgctcgagatacacccagaggagattggtatctacaacgatttc
ttcagtctgggaggtgatagtctaaagagcacgaaactttcattcatggtccacgagacc
ttcagccgcgcggtctcggtcagcacccttttccgtcatcgaacaatcgaggcactagca
cagctgatcataaacaattctgtggatgtgaacgaaattactccactagaatataatgag
gggcagatgattcccgtgtccggggcccaggagcgacttctcttcattcacgagtttgag
aatggcagtaatgcatacaacattgacatctcctataaattgcctggctcagttgacgcc
ttgaatctcgagcaggcgctgcgtggaatcctttctcgacacgaggcgttgagaacgttg
cttgtcaaggacgacacaactggcagctatattcagaagatattgagccccgatggcgcc
cagcgcatgttctccgtcaaggcggacgtaatcaaggccatggagcaattggaccaagaa
agggccagtctatcccagcacattttccgcctgggtgatgaactgccttggcaagcccgt
atccttaggcacgaatcaggcagcttgtatctcatcgtaacgttccaccataccagcttc
gatgcatggtcgttaagtgtatttgagcgagaacttcaagccttgtacgtggccctccac
aaaacaaagagtgcagcgagcctgcccacactcagagtccaatacaaggattacgcccag
taccatcgtcggcagctgtcacggagtcaccgtagcctatccgacttttggttgcaaaag
ctcagtggcttggaatcattgcagctgatcacggaccgtccacgaccggggcatttcaac
tacgacggcgacgatctcagtatcgagctgggtcaaaaggaaacacagaacctgagagag
gttgccaaagaatgcaagtctagcctgtacgtcgtcttgctatccgcttattacgtgatg
cttgcgtcgtacgcgaaccagacggacatcgcagtgggtatcccaatcagccaccgaaca
cacccccaattccagtccatcattggattcttcgtcaacctggttgtgcttagagtggat
gtatctcattctgccattggcgacctcatcagaagggtgatgaaagagctcgtccaagca
cagttacaccaagacatgccgttccaggaggtcacgaagctgttgcaggtagttaatgat
gctagccggcatccattagtacagactgttttcaacttcgaagcccgtccagatgaagaa
cacgattctgggtcgcaggatgagggggcaatccaatttactcaataccggccggttcag
cccctagattcagttgcgaaattcgatctgaatgcaacggtcaccgaactggagtcaggt
atgagggtcaacttcaactacgccaccagcttgttcaacaggagcacgattgagggcttt
ttgcgtacctacgaatatctccttcaccagctgtcggagctaagtgcagaaggaatcaag
gaggatacgcagctgttgttggttcctccgcgagagattggcgatgcgcacctaccgttg
gcacagtctccgcttgcaactcttgctgaggagcggaatgcagcgtcgctaagccaggcc
tttgagtacgaagcttccctagccccaggtaaaattgctatcgctcagggggatagggta
ctcagctttgccgatctcaacaagcgggctaaccagctatcacgatacatgttgtccata
tcctccctcggggcggaagggcgagtagctctgatgctggacaagagcatcgagacaatt
gtttgcattctggcgatatggaagactggtgcagcatatgtgcccttggatccaacttac
ccgacgcagcgcgtccggctgatcctggaggagacccaggcgaagaccgttcttgtaaac
tcccatcatgtctctaaatgtgaatacatgggcgcaaaggtcgtatcaatcgactcaccc
gccgtcaagaccgaagtcagccaacagttgagctctgacttgcctgcagttgccggtttg
gacaacctggcgtatataatctttacttcaggtacttccggcaagcccaagggcgttctg
gttgagcaaaagggtgttctactattgcgtgatgccctccgggaacggtatttcggcaat
gactgcaccaagcagcattctgtacttttcctttctaactatgtcttcgacttctctgta
gagcaacttgtgttatcggtgctcagcggacacaagttgatcgttcctccggcagatttc
gtcgtcgatgaagaattctataggatggccaacactcacggtctctcgtatctcagtgga
accccatccttgctgcagcagatcgatctggcacaactacaccacctgcagtccgtgact
gcagcaggagagttgcttcatgccacgcagtacgagaagatgcgcagcagttttggcggt
acgatctacaatgcttatggcatcaccgagaccacggtgtacaacattatcactgaattc
actgtgaattcgaattttgaaaatgctatacgcgacgtgcttcccggcacccgagcgtat
ctgctgaacaaggcacttcaacccgtcccgtttgacgcagtcggagagctctatctggct
ggtgactgcgttacacgtggttatctcaatgagcctcttctaacagatcagcgcttcctt
cccaaccctttccggaaccaggaggacttcgccgctgggcgtttctcgctactctacaag
accggcgacctgtttcggtgccggttcagccatcaacagcagccacaactagaataccta
ggaagagacgacttgcaggtcaagatgagagggtaccggatcgaactttctgaagtgcag
aatatacttgcgtctagtcccggtgtccaggagtgcgcagtcgttgccaagtatgacaag
gacgatagctattcacggatcgctcagtctatagtcggctactataccactgacaacgaa
gctgtgtcagaagccaacattctcacctccatgaaagccaggcttccaacctacatggtg
cccagccacctctgccgtctggagggtgcacttcctgtgaccattaatggaaagcttgac
atcaaaagactgccagaaattggcaacgcatcagtggtgttatcatacagtccgccgagg
aacatactagaggctagggtatgcaagctgtgggcatctgtcttgggtatcgaacgatgc
ggtatcgatgatgacctgttcaaactgggtggtgatagcatcatgtcattgcaccttgtg
gcccagattcacaatcaggtcggtcgcaaggtcaccgttcgggatatcttcgagtatcgt
actattcgagccctccatgaccacgtcttcatgaaggacatagacacgagtgttgtggac
cagttccgtagcgaacaagggctggtggttggtgaggccccccttctgccaattcagaac
tggttcctgtccaagccactgcagcatccgagctattggaatcatactttctacatccga
actccagagctggatgttactttgctgagagctgccatcatcgaattgcaacagtatcat
gacgctttccgcatgcgactgaggcgcaaggataataaaattgtacagttctttgttaag
gacgcttctcctgtccagcttcgggtgctaaacatgaaggatgttgacggacctacggcc
attaacgaaacactgagcgagtggcagtcgggctttgaccttgagaaggggccaatctgc
gccattgggtacctgcatgggtacgaagaccgatccgcgcggatatggttctccatccat
cacatcgccgttgacaccgtcagctggcaaatcttggtccgtgacttgcagatgctctat
cagaatggaagcctggggtgcaagggcagcagtattcgacagtggtctgaagcggtacaa
aattaccaaccgtcaaagtctgaattcggtcactggaacgacctcattgcgcgaacaact
tccagcatctctgcgcttcctgcatcgaccggttgccgcgtacgtctgaccaggaatttg
agcactgagaagacagctttgctgctccaaggcagcaaaggtggacaggaggtctctgtg
tacgactctctactggctgcggttggattggcactccaagctatctgttcaagaggccca
agtatggtcacaatcgagggacatggtcgggaggaagatgttgaccatacactggatgtc
agccgcaccatgggttggttcaccagtatgtatccgtttgagatcccccatctccgaacc
gagaaccttgttgagggagtggccgctataaacgaacggttaaggcaggtccctgctcga
ggaatcggctatggagcgttgtacggctatactcgacacccgttgcctcagattaccgtc
aactacctgggtcatctcgctccaaaaaagtcaaaactagacgaatgggctctcgccgtg
ggcgataatggactcgagtatggactcatgacaagcccagaggacaaggacaagagctcc
tccgccgttgatgtcaccgctgtgcatattgatgctactatcacaatcgacatggacagt
gcttggagccttgaggacagtgagaaatttatctcaaacatcgaagaaggacttaacaag
atcatcgacagcgtgacaagccaagaaacctcatccccagcggatcctcaattaaccgag
gagacgtacacaccgtattttgagtatctggagccgtcacgacagggcccaacgctgttc
ctgctgcccccgggcgaaggaggagccgaaagctacttcaacaacatcgtcaaacaccta
cctgggacaaacatggtcgcctttaacaattactacttgcatagcaaacgcctgcgcacg
ttcgaggagctggcggaaatgtatcttgaccatgtacgcaacattcaaccacatggaccg
taccacttcattggatggagttttggaggaatccttgcgatggagatgtcccggcggctg
gcaacatcgggcgaaaagattggcctccttggtatcatagacacatacttcaatgtgcac
ggagcaacacgcagcattggcctgggagacgccaagatcttagaccctatccaccacatc
taccaccccgatccgacgaatttcaaaggcctgccatctgccacagatcacatcgtgctg
ttcaaggccatgaagacgaacgatcagtatgaatcggagaatcagcgtcacctgtacgag
tactacgacgggacacccttgaatgatatggacaaattgctgccaagtgataccgctatt
cagctggtcccgcttactgacgatactcacttttcttgggccagaaatccccagcaagta
caccggatgtgtgcggccatcaaggactatctttctggttattag

DBGET integrated database retrieval system