KEGG   Aspergillus oryzae: AOR_1_94154Help
Entry
AOR_1_94154       CDS       T01018                                 

Gene name
AO090003000054
Definition
eukaryotic translation initiation factor 3 subunit J
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
aor  Aspergillus oryzae
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:aor00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AOR_1_94154 (AO090003000054)
Translation factors [BR:aor03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    AOR_1_94154 (AO090003000054)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 265 aa AA seqDB search
MAPERWDDEEDSVSPPPVAPRRRFDDEEEDEVLDSWDAAEDSEVEREKAAKAAEAKAKAD
AEAAAKKKSKSQRIQEHKEERKKKAEEEDSDSEEEDDADKRARLRRAQKDADLKHAEDLF
GDIDLNRNRGAPKAIVISDSADPTQAVDLSAMPLFKPTTKEQFARLTSTLIPLLTPHSKK
PHYSLWAQEFAKQLVKELNSADVKKIASAMTTMSNEKMREERAADKGSKKSKAAKTKVSL
VTSRDNKLDADYDNGDDGLGDDDFM
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccgaacggtgggacgatgaggaggacagtgtctcccctcctcctgtggctcct
cgtcgcagattcgacgatgaagaagaagatgaggtcctcgactcctgggacgccgctgaa
gactccgaagtagagcgggaaaaggcagccaaagcggccgaagccaaggctaaggccgac
gccgaagctgccgcaaagaagaagagcaagtcgcagcgtatacaggaacacaaggaggag
cgcaaaaagaaggccgaagaggaggattccgacagcgaggaggaggacgatgccgacaag
agagcccgtctgcgccgcgcccagaaggatgccgatctcaagcacgctgaagatctgttc
ggtgatatcgacctcaaccggaaccgcggcgcccccaaggctatcgttattagtgactcg
gccgacccgacgcaggccgtcgatctttctgccatgcctttattcaagcctaccactaag
gagcagttcgctcgtttgacttccacccttatcccgctcctgactccccattcgaagaag
cctcactattccctgtgggcgcaggagtttgctaagcagcttgttaaggagctgaacagc
gcagatgtcaagaagatcgctagtgctatgactactatgagcaacgagaagatgagagag
gagcgcgccgctgacaagggcagcaagaagagcaaggcggccaagacgaaggtgtcactg
gttacttccagagataacaagcttgatgctgattatgacaatggtgatgatggattgggt
gatgacgatttcatgtga

DBGET integrated database retrieval system