KEGG   Aspergillus oryzae: AOR_1_944054Help
Entry
AOR_1_944054      CDS       T01018                                 

Gene name
AO090011000557
Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
aor  Aspergillus oryzae
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:aor01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:aor00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 295 aa AA seqDB search
MPTNTITLIISPYHVGLRDHRVGNGPHRIQSQGLIPTLKEQGLQFRIHEIPSVDNFEGEI
GRSFEILRRISVAVTEAVDNNTFPLILAGNCMSSAAVACGLKIHDLSFIYFDAHDDLDSP
DVNENGYFDAMGLSMLRGESWKTLMGTVPNYKPFSYEDRFLYCGLRDQSDVQRQRVVEAG
MKAVWGETARKVDFVGELRTQMEERSYGSALVHLDLDVLDESYGKVNDYPSPGGLTEEDL
VACMDLVPRLSEPRSLTVCSFDPDVGDGDTIARIGIRAIRAFVGALLETGVLIRG
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgccaaccaacaccataaccctaatcatctcaccttaccacgtcggcctgcgggatcac
cgcgtaggcaacggcccccaccgcatccaatcccagggcttaatccccaccctcaaagaa
cagggtctccaattccgcatccacgaaatccccagcgtggacaacttcgaaggcgagatc
ggccgaagcttcgagatcctccgccggatttcagtcgctgtcacagaagccgtggacaac
aacaccttcccgttaattctggcgggaaattgcatgtccagcgcggcggtggcttgcggc
ctgaagatccacgatctatcgtttatttacttcgatgctcatgatgacctggactcaccg
gatgtcaatgaaaatgggtactttgatgccatgggtttgtccatgctacggggtgaatcg
tggaagacgttaatggggaccgtgccgaattataagccgtttagttacgaggaccggttt
ctttactgtgggttgcgggatcagtctgatgtgcagcggcagagggttgttgaggccggg
atgaaggctgtttggggggagacggcgaggaaggttgattttgtgggtgagttgaggacg
cagatggaggagaggtcgtatgggtctgctcttgtgcatctggatctggatgtcttggat
gagtcttatgggaaggttaatgattatccgtcgccgggaggtttgacggaggaggatttg
gtggcttgtatggatctggtgccgaggctgtctgagcctaggtctttgacggtgtgttcg
tttgatccggatgttggggatggggatacgattgctaggattgggattcgggcgatcaga
gctttcgtgggggctttgttagagacgggggttctgattaggggttga

DBGET integrated database retrieval system